Rabbit TIMM8B Polyclonal Antibody | anti-TIMM8B antibody

TIMM8B Rabbit pAb

Cat. Num. AAA9142114

• Gene Names: TIMM8B; DDP2; TIM8B
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry, Immunofluorescence
• Purity: Affinity purification
• Synonyms: TIMM8B; Polyclonal Antibody; TIMM8B Rabbit pAb; DDP2; TIM8B; anti-TIMM8B antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Sequence: MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGGQ

• Applicable Applications for anti-TIMM8B antibody: Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
• Application Notes: WB: 1:500-1:2000; IHC: 1:50-1:100; IF: 1:50-1:100
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 16-98 of human TIMM8B (NP_036591.2).
• Cellular Location: Intermembrane side, Mitochondrion inner membrane, Peripheral membrane protein
• Positive Samples: 293T, A-549, MCF7, Mouse brain, Mouse kidney, Rat liver
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using TIMM8B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded rat brain using TIMM8B antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded human breast cancer using TIMM8B antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded mouse heart using TIMM8B antibody at dilution of 1:100 (40x lens).)

Immunofluorescence (IF)

(Immunofluorescence analysis of L929 cells using TIMM8B Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Immunofluorescence (IF)

(Immunofluorescence analysis of U-2 OS cells using TIMM8B Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Related Product Information for anti-TIMM8B antibody

Background: This gene encodes a member of a well-conserved family of proteins with similarity to yeast Tim mitochondrial import proteins. This gene is encoded by a nuclear gene and is transported into the intermembrane space of the mitochondrion. When formed into complexes, these proteins guide membrane-spanning proteins across the mitochondrial intermembrane space before they are added into the mitochondrial inner membrane. This gene is adjacent to succinate dehydrogenase, subunit D (SDHD), in which mutations have been found in affected members of families with hereditary paraganglioma.

NCBI and Uniprot Product Information

• NCBI GI #: 6524627
• NCBI GeneID: 26521
• UniProt Accession #: Q9Y5J9; Q3KQS9; Q9UN04; B0YJA5
• Molecular Weight: 9,344 Da
• NCBI Official Full Name: TIMM8b
• NCBI Official Synonym Full Names: translocase of inner mitochondrial membrane 8 homolog B (yeast)
• NCBI Official Symbol: TIMM8B
• NCBI Official Synonym Symbols: DDP2; TIM8B
• NCBI Protein Information: mitochondrial import inner membrane translocase subunit Tim8 B; DDP-like protein; deafness dystonia protein 2
• UniProt Protein Name: Mitochondrial import inner membrane translocase subunit Tim8 B
• Protein Family: Mitochondrial import inner membrane translocase
• UniProt Gene Name: TIMM8B
• UniProt Synonym Gene Names: DDP2; DDPL; TIM8B
• UniProt Entry Name: TIM8B_HUMAN

NCBI Description

This gene encodes a member of a well-conserved family of proteins with similarity to yeast Tim mitochondrial import proteins. This gene is encoded by a nuclear gene and is transported into the intermembrane space of the mitochondrion. When formed into complexes, these proteins guide membrane-spanning proteins across the mitochondrial intermembrane space before they are added into the mitochondrial inner membrane. This gene is adjacent to succinate dehydrogenase, subunit D (SDHD), in which mutations have been found in affected members of families with hereditary paraganglioma.[provided by RefSeq, Aug 2009]

Uniprot Description

Function: Probable mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space

By similarity.

Subunit structure: Heterohexamer; possibly composed of 3 copies of TIMM8B and 3 copies of TIMM13, named soluble 70 kDa complex. Associates with the TIM22 complex, whose core is composed of TIMM22

By similarity.

Subcellular location: Mitochondrion inner membrane; Peripheral membrane protein; Intermembrane side

By similarity.

Tissue specificity: Ubiquitous, with highest expression in heart, kidney, liver and skeletal muscle. Ref.2

Domain: The twin CX3C motif contains 4 conserved Cys residues that form 2 disulfide bonds in the mitochondrial intermembrane space. However, during the transit of TIMM8B from cytoplasm into mitochondrion, the Cys residues probably coordinate zinc, thereby preventing folding and allowing its transfer across mitochondrial outer membrane

By similarity.

Sequence similarities: Belongs to the small Tim family.