Western Blot (WB)
(Host: RabbitTarget Name: TIMM23Sample Tissue: Human Thymus Tumor lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human TIMM23 Polyclonal Antibody | anti-TIMM23 antibody
TIMM23 Antibody - C-terminal region
Gene Names
TIMM23; TIM23
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TIMM23; Polyclonal Antibody; TIMM23 Antibody - C-terminal region; anti-TIMM23 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQ
Sequence Length
209
Applicable Applications for anti-TIMM23 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TIMM23
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: TIMM23Sample Tissue: Human Thymus Tumor lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: TIMM23Sample Tissue: Human Thymus Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TIMM23 antibody
The protein encoded by this gene is part of a complex located in the inner mitochondrial membrane that mediates the transport of transit peptide-containing proteins across the membrane. Multiple transcript variants, one protein-coding and others not protein-coding, have been found for this gene.
Product Categories/Family for anti-TIMM23 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23 kDa
NCBI Official Full Name
mitochondrial import inner membrane translocase subunit Tim23
NCBI Official Synonym Full Names
translocase of inner mitochondrial membrane 23
NCBI Official Symbol
TIMM23
NCBI Official Synonym Symbols
TIM23
NCBI Protein Information
mitochondrial import inner membrane translocase subunit Tim23
UniProt Protein Name
Mitochondrial import inner membrane translocase subunit Tim23
Protein Family
UniProt Gene Name
TIMM23
UniProt Synonym Gene Names
TIM23
NCBI Description
The protein encoded by this gene is part of a complex located in the inner mitochondrial membrane that mediates the transport of transit peptide-containing proteins across the membrane. Multiple transcript variants, one protein-coding and others not protein-coding, have been found for this gene. [provided by RefSeq, Jul 2012]
Uniprot Description
Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Research Articles on TIMM23
Similar Products
Product Notes
The TIMM23 timm23 (Catalog #AAA3219852) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TIMM23 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TIMM23 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TIMM23 timm23 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VAAGTMTGML YKCTGGLRGI ARGGLTGLTL TSLYALYNNW EHMKGSLLQQ. It is sometimes possible for the material contained within the vial of "TIMM23, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
