Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human kidney )

Rabbit TIMELESS Polyclonal Antibody | anti-TIMELESS antibody

TIMELESS antibody - N-terminal region

Gene Names
TIMELESS; TIM; TIM1; hTIM
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
TIMELESS; Polyclonal Antibody; TIMELESS antibody - N-terminal region; anti-TIMELESS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IGERDLIFHKGLHNLRNYSSDLGKQPKKVPKRRQAARELSIQRRSALNVR
Sequence Length
1208
Applicable Applications for anti-TIMELESS antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 92%; Dog: 85%; Guinea Pig: 77%; Horse: 85%; Human: 100%; Mouse: 85%; Pig: 85%; Rabbit: 77%; Rat: 85%; Sheep: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TIMELESS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human kidney )

Immunohistochemistry (IHC) (Human kidney )

Western Blot (WB)

(WB Suggested Anti-TIMELESS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-TIMELESS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)
Related Product Information for anti-TIMELESS antibody
This is a rabbit polyclonal antibody against TIMELESS. It was validated on Western Blot and immunohistochemistry

Target Description: The human Timeless protein interacts with both the circadian clock protein cryptochrome 2 and with the cell cycle checkpoint proteins Chk1 and the ATR-ATRIP complex and plays an important role in the DNA damage checkpoint response. Down-regulation of Timeless in human cells seriously compromises replication and intra-S checkpoints, indicating an intimate connection between the circadian cycle and the DNA damage checkpoints that is in part mediated by the Timeless protein.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
139kDa
NCBI Official Full Name
protein timeless homolog isoform 1
NCBI Official Synonym Full Names
timeless circadian regulator
NCBI Official Symbol
TIMELESS
NCBI Official Synonym Symbols
TIM; TIM1; hTIM
NCBI Protein Information
protein timeless homolog
UniProt Protein Name
Protein timeless homolog
UniProt Gene Name
TIMELESS
UniProt Synonym Gene Names
hTIM
UniProt Entry Name
TIM_HUMAN

NCBI Description

The protein encoded by this gene is highly conserved and is involved in cell survival after damage or stress, increase in DNA polymerase epsilon activity, maintenance of telomere length, and epithelial cell morphogenesis. The encoded protein also plays a role in the circadian rhythm autoregulatory loop, interacting with the PERIOD genes (PER1, PER2, and PER3) and others to downregulate activation of PER1 by CLOCK/ARNTL. Changes in this gene or its expression may promote prostate cancer, lung cancer, breast cancer, and mental disorders. [provided by RefSeq, Feb 2014]

Uniprot Description

TIMELESS: Required for normal progression of S-phase. Involved in the circadian rhythm autoregulatory loop. Negatively regulates CLOCK-NPAS2/BMAL1-induced transactivation of PER1 possibly via translocation of PER1 into the nucleus. Promotes TIPIN nuclear localiZation. Involved in cell survival after DNA damage or replication stress. May be specifically required for the ATR-CHEK1 pathway in the replication checkpoint induced by hydroxyurea or ultraviolet light. May also play an important role in epithelial cell morphogenesis and formation of branching tubules. Belongs to the timeless family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 12q13.3

Cellular Component: microtubule cytoskeleton; nuclear chromatin; nucleolus; nucleus

Molecular Function: protein binding; protein homodimerization activity; protein heterodimerization activity

Biological Process: circadian rhythm; mitosis; transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter; regulation of circadian rhythm; regulation of cell proliferation; branching morphogenesis of a tube; response to abiotic stimulus; cell division; morphogenesis of an epithelium; negative regulation of transcription, DNA-dependent; response to DNA damage stimulus; detection of abiotic stimulus; lung development

Research Articles on TIMELESS

Similar Products

Product Notes

The TIMELESS timeless (Catalog #AAA3201914) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TIMELESS antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's TIMELESS can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the TIMELESS timeless for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IGERDLIFHK GLHNLRNYSS DLGKQPKKVP KRRQAARELS IQRRSALNVR. It is sometimes possible for the material contained within the vial of "TIMELESS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.