anti-Human TIM 1 Polyclonal Antibody | anti-TIM 1 antibody
Anti-TIM 1 Antibody
Gene Names
HAVCR1; TIM; KIM1; TIM1; CD365; HAVCR; KIM-1; TIM-1; TIMD1; TIMD-1; HAVCR-1
Reactivity
Human
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
TIM 1; Polyclonal Antibody; Anti-TIM 1 Antibody; Hepatitis A virus cellular receptor 1 homolog(HAVcr-1); HAVCR 1; HAVcr-1; HAVCR1; Hepatitis A virus cellular receptor 1; Kidney injury molecule 1; KIM 1; KIM-1; T cell immunoglobin domain and mucin domain protein 1; T-cell immunoglobulin and mucin domain-containing protein 1; T-cell membrane protein 1; TIM; TIM-1; TIM1; TIMD 1; TIMD-1; TIMD1; TIMD1_HUMAN antibody; hepatitis A virus cellular receptor 1; anti-TIM 1 antibody
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
364
Applicable Applications for anti-TIM 1 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human TIM 1 (321-359aa QQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSLYATD).
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Western Blot (WB)
(Anti- TIM1 antibody, Western blottingAll lanes: Anti TIM1 at 0.5ug/ml)
Related Product Information for anti-TIM 1 antibody
Description: Rabbit IgG polyclonal antibody for Hepatitis A virus cellular receptor 1 homolog(HAVcr-1)(HAVCR1) detection. Tested with WB in Human.
Background: KIM1 (KIDNEY INJURY MOLECULE 1), also known as HAVCR1, HAVCR or TIM1, is a protein that in humans is encoded by the KIM1 gene. The KIM1 gene is mapped to 5q33.3. Biochemical, mutational, and cell adhesion analyses confirm that Tim1 is capable of homophilic Tim-Tim interactions. The features identified in murine KIM1 are conserved in human KIM1. The KIM1 protein is indeed a receptor for the virus through the infection of canine osteogenic sarcoma cells expressing HAVCR1 with HAV. Using a monoclonal antibody to mouse Tim1, Tim1 is expressed after activation of naive T cells and on T cells differentiated in Th2-polarizing conditions. Ectopic expression of KIM1 during mouse T-cell differentiation leads to production of the Th2-type cytokine Il4, but not the Th1-type cytokine Ifng. KIM1-expressing epithelial cells internalized apoptotic bodies, and Kim1 is directly responsible for phagocytosis in cultured primary rat tubule epithelial cells and in porcine and canine epithelial cell lines.
Background: KIM1 (KIDNEY INJURY MOLECULE 1), also known as HAVCR1, HAVCR or TIM1, is a protein that in humans is encoded by the KIM1 gene. The KIM1 gene is mapped to 5q33.3. Biochemical, mutational, and cell adhesion analyses confirm that Tim1 is capable of homophilic Tim-Tim interactions. The features identified in murine KIM1 are conserved in human KIM1. The KIM1 protein is indeed a receptor for the virus through the infection of canine osteogenic sarcoma cells expressing HAVCR1 with HAV. Using a monoclonal antibody to mouse Tim1, Tim1 is expressed after activation of naive T cells and on T cells differentiated in Th2-polarizing conditions. Ectopic expression of KIM1 during mouse T-cell differentiation leads to production of the Th2-type cytokine Il4, but not the Th1-type cytokine Ifng. KIM1-expressing epithelial cells internalized apoptotic bodies, and Kim1 is directly responsible for phagocytosis in cultured primary rat tubule epithelial cells and in porcine and canine epithelial cell lines.
References
1. de Souza, A. J., Oriss, T. B., O'Malley, K. J., Ray, A., Kane, L. P. T cell Ig and mucin 1 (TIM-1) is expressed on in vivo-activated T cells and provides a costimulatory signal for T cell activation. Proc. Nat. Acad. Sci. 102: 17113-17118, 2005. 2. Feigelstock, D., Thompson, P., Mattoo, P., Zhang, Y., Kaplan, G. G. The human homolog of HAVcr-1 codes for a hepatitis A virus cellular receptor. J. Virol. 72: 6621-6628, 1998.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38,720 Da
NCBI Official Full Name
hepatitis A virus cellular receptor 1 isoform a
NCBI Official Synonym Full Names
hepatitis A virus cellular receptor 1
NCBI Official Symbol
HAVCR1
NCBI Official Synonym Symbols
TIM; KIM1; TIM1; CD365; HAVCR; KIM-1; TIM-1; TIMD1; TIMD-1; HAVCR-1
NCBI Protein Information
hepatitis A virus cellular receptor 1
UniProt Protein Name
Hepatitis A virus cellular receptor 1
UniProt Gene Name
HAVCR1
UniProt Synonym Gene Names
KIM1; TIM1; TIMD1; HAVcr-1; KIM-1; TIMD-1; TIM; TIM-1
UniProt Entry Name
HAVR1_HUMAN
NCBI Description
The protein encoded by this gene is a membrane receptor for both human hepatitis A virus (HHAV) and TIMD4. The encoded protein may be involved in the moderation of asthma and allergic diseases. The reference genome represents an allele that retains a MTTVP amino acid segment that confers protection against atopy in HHAV seropositive individuals. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 4, 12 and 19. [provided by RefSeq, Apr 2015]
Uniprot Description
TIM-1: May play a role in T-helper cell development and the regulation of asthma and allergic diseases. Receptor for TIMD4. In case of human hepatitis A virus (HHAV) infection, functions as a cell-surface receptor for the virus. May play a role in kidney injury and repair. Belongs to the immunoglobulin superfamily. TIM family.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 5q33.2
Cellular Component: integral to membrane
Molecular Function: viral receptor activity
Biological Process: entry of virus into host cell
Disease: Ige Responsiveness, Atopic
