Rabbit anti-Mouse, Rat THY1 Polyclonal Antibody | anti-THY1 antibody

THY1 Polyclonal Antibody

Cat. Num. AAA9141021

• Gene Names: THY1; CD90; CDw90
• Reactivity: Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Affinity Purification
• Synonyms: THY1; Polyclonal Antibody; THY1 Polyclonal Antibody; CD90; CDw90; Thy-1 cell surface antigen; anti-THY1 antibody

• Host: Rabbit
• Reactivity: Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Concentration: 3.53 mg/ml (varies by lot)
• Sequence Length: 161

• Applicable Applications for anti-THY1 antibody: Western Blot (WB), Immunohistochemistry (IHC)
• Application Notes: WB: 1:500-1:2000; IHC: 1:50-1:200
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 31-81 of human THY1 (NP_006279.2).
• Immunogen Sequence: DQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFT
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

Immunohistochemistry (IHC)

(Immunohistochemistry-THY1 Polyclonal Antibody)

Immunohistochemistry (IHC)

(Immunohistochemistry-THY1 Polyclonal Antibody)

Related Product Information for anti-THY1 antibody

This gene encodes a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins. The encoded protein is involved in cell adhesion and cell communication in numerous cell types, but particularly in cells of the immune and nervous systems. The encoded protein is widely used as a marker for hematopoietic stem cells. This gene may function as a tumor suppressor in nasopharyngeal carcinoma. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

• NCBI GI #: 19923362
• NCBI GeneID: 7070
• NCBI Accession #: NP_006279.2
• NCBI GenBank Nucleotide #: NP_006279.2
• UniProt Accession #: P04216
• Molecular Weight: 17kDa
• NCBI Official Full Name: thy-1 membrane glycoprotein preproprotein
• NCBI Official Synonym Full Names: Thy-1 cell surface antigen
• NCBI Official Symbol: THY1
• NCBI Official Synonym Symbols: CD90; CDw90
• NCBI Protein Information: thy-1 membrane glycoprotein
• UniProt Protein Name: Thy-1 membrane glycoprotein
• Protein Family: Thy-1 membrane glycoprotein
• UniProt Gene Name: THY1
• UniProt Entry Name: THY1_HUMAN

NCBI Description

This gene encodes a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins. The encoded protein is involved in cell adhesion and cell communication in numerous cell types, but particularly in cells of the immune and nervous systems. The encoded protein is widely used as a marker for hematopoietic stem cells. This gene may function as a tumor suppressor in nasopharyngeal carcinoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2015]

Uniprot Description

THY1: May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain.

Protein type: Motility/polarity/chemotaxis; Membrane protein, GPI anchor; Cell adhesion

Chromosomal Location of Human Ortholog: 11q23.3

Cellular Component: anchored to external side of plasma membrane; focal adhesion; growth cone; endoplasmic reticulum; integral to plasma membrane; dendrite; apical plasma membrane; plasma membrane; cytosol; lipid raft; external side of plasma membrane

Molecular Function: integrin binding; protein binding; protein kinase binding

Biological Process: focal adhesion formation; cell-cell adhesion; retinal cone cell development; negative regulation of T cell receptor signaling pathway; negative regulation of protein kinase activity; negative regulation of axonogenesis; cytoskeleton organization and biogenesis; angiogenesis; positive regulation of T cell activation; positive regulation of release of sequestered calcium ion into cytosol; T cell receptor signaling pathway; negative regulation of cell migration; positive regulation of GTPase activity