Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CLASP2 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole CellThere is BioGPS gene expression data showing that CLASP2 is expressed in ACHN)

Rabbit CLASP2 Polyclonal Antibody | anti-CLASP2 antibody

CLASP2 Antibody - C-terminal region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CLASP2; Polyclonal Antibody; CLASP2 Antibody - C-terminal region; anti-CLASP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VAVHAVIGDELKPHLSQLTGSKMKLLNLYIKRAQTGSGGADPTTDVSGQS
Sequence Length
1294
Applicable Applications for anti-CLASP2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CLASP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CLASP2 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole CellThere is BioGPS gene expression data showing that CLASP2 is expressed in ACHN)

Western Blot (WB) (WB Suggested Anti-CLASP2 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole CellThere is BioGPS gene expression data showing that CLASP2 is expressed in ACHN)
Related Product Information for anti-CLASP2 antibody
This is a rabbit polyclonal antibody against CLASP2. It was validated on Western Blot

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-CLASP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
142kDa
NCBI Official Full Name
CLIP-associating protein 2
NCBI Official Synonym Full Names
cytoplasmic linker associated protein 2
NCBI Official Symbol
CLASP2
NCBI Protein Information
CLIP-associating protein 2
UniProt Protein Name
CLIP-associating protein 2
Protein Family
UniProt Gene Name
CLASP2
UniProt Synonym Gene Names
KIAA0627; hOrbit2
UniProt Entry Name
CLAP2_HUMAN

Uniprot Description

CLASP2: Microtubule plus-end tracking protein that promotes the stabilization of dynamic microtubules. Involved in the nucleation of noncentrosomal microtubules originating from the trans-Golgi network (TGN). Required for the polarization of the cytoplasmic microtubule arrays in migrating cells towards the leading edge of the cell. May act at the cell cortex to enhance the frequency of rescue of depolymerizing microtubules by attaching their plus-ends to cortical platforms composed of ERC1 and PHLDB2. This cortical microtubule stabilizing activity is regulated at least in part by phosphatidylinositol 3-kinase signaling. Also performs a similar stabilizing function at the kinetochore which is essential for the bipolar alignment of chromosomes on the mitotic spindle. Acts as a mediator of ERBB2-dependent stabilization of microtubules at the cell cortex. Belongs to the CLASP family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Cytoskeletal

Chromosomal Location of Human Ortholog: 3p22.3

Cellular Component: kinetochore microtubule; Golgi apparatus; microtubule; membrane; cytoplasmic microtubule; cytoplasm; plasma membrane; microtubule organizing center; cell cortex; trans-Golgi network; cytosol

Molecular Function: microtubule plus-end binding; protein binding; galactoside 2-alpha-L-fucosyltransferase activity

Biological Process: mitosis; microtubule organizing center organization and biogenesis; axon guidance; regulation of microtubule-based process; cell division; negative regulation of microtubule depolymerization; establishment and/or maintenance of cell polarity; mitotic cell cycle; microtubule nucleation; regulation of microtubule polymerization or depolymerization

Research Articles on CLASP2

Similar Products

Product Notes

The CLASP2 clasp2 (Catalog #AAA3216528) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CLASP2 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CLASP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CLASP2 clasp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VAVHAVIGDE LKPHLSQLTG SKMKLLNLYI KRAQTGSGGA DPTTDVSGQS. It is sometimes possible for the material contained within the vial of "CLASP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.