Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-THRAP3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)

Rabbit THRAP3 Polyclonal Antibody | anti-THRAP3 antibody

THRAP3 antibody - C-terminal region

Gene Names
THRAP3; BCLAF2; TRAP150
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
THRAP3; Polyclonal Antibody; THRAP3 antibody - C-terminal region; anti-THRAP3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GRGAFPRGRGRFMFRKSSTSPKWAHDKFSGEEGEIEDDESGTENREEKDN
Sequence Length
955
Applicable Applications for anti-THRAP3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human THRAP3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-THRAP3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-THRAP3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)
Related Product Information for anti-THRAP3 antibody
This is a rabbit polyclonal antibody against THRAP3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: THRAP3 plays a role in transcriptional coactivation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
109kDa
NCBI Official Full Name
thyroid hormone receptor-associated protein 3 isoform 1
NCBI Official Synonym Full Names
thyroid hormone receptor associated protein 3
NCBI Official Symbol
THRAP3
NCBI Official Synonym Symbols
BCLAF2; TRAP150
NCBI Protein Information
thyroid hormone receptor-associated protein 3
UniProt Protein Name
Thyroid hormone receptor-associated protein 3
UniProt Gene Name
THRAP3
UniProt Synonym Gene Names
TRAP150; Trap150
UniProt Entry Name
TR150_HUMAN

Uniprot Description

Trap150: Plays a role in transcriptional coactivation.

Protein type: Transcription, coactivator/corepressor; RNA-binding

Chromosomal Location of Human Ortholog: 1p34.3

Cellular Component: nucleoplasm; Srb-mediator complex; nucleus

Molecular Function: protein binding; ligand-dependent nuclear receptor transcription coactivator activity; vitamin D receptor binding; transcription coactivator activity; transcription cofactor activity; phosphoprotein binding; thyroid hormone receptor binding; receptor activity; ATP binding

Biological Process: steroid hormone receptor signaling pathway; positive regulation of nuclear mRNA splicing, via spliceosome; transcription initiation from RNA polymerase II promoter; mRNA stabilization; positive regulation of transcription, DNA-dependent; RNA splicing; androgen receptor signaling pathway; rhythmic process; positive regulation of transcription from RNA polymerase II promoter; positive regulation of circadian rhythm; mRNA processing; regulation of alternative nuclear mRNA splicing, via spliceosome

Research Articles on THRAP3

Similar Products

Product Notes

The THRAP3 thrap3 (Catalog #AAA3204152) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The THRAP3 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's THRAP3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the THRAP3 thrap3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GRGAFPRGRG RFMFRKSSTS PKWAHDKFSG EEGEIEDDES GTENREEKDN. It is sometimes possible for the material contained within the vial of "THRAP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.