anti-Human UHRF1 Polyclonal Antibody | anti-UHRF1 antibody

Anti-UHRF1 Antibody

Cat. Num. AAA177743

• Gene Names: UHRF1; Np95; hNP95; ICBP90; RNF106; TDRD22; hUHRF1; huNp95
• Reactivity: Human
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: UHRF1; Polyclonal Antibody; Anti-UHRF1 Antibody; E3 ubiquitin-protein ligase UHRF1; Ac2-121; AL022808; EC 6.3.2.-; FLJ21925; hNP95; hUHRF1; HuNp95; ICBP90; Inverted CCAAT box binding protein of 90 kDa; Inverted CCAAT box binding protein; 90-kD; Inverted CCAAT box-binding protein of 90 kDa; Liver regeneration-related protein LRRG126; MGC138707; NP95; Nuclear phosphoprotein; 95-KD; Nuclear protein 95; Nuclear zinc finger protein Np95; RING finger protein 106; RNF106; Transcription factor ICBP90; Ubiquitin like containing PHD and RING finger domains protein 1; Ubiquitin like PHD and RING finger domain containing protein 1; Ubiquitin-like PHD and RING finger domain-containing protein 1; Ubiquitin-like protein containing PHD and RING finger domains 1; Ubiquitin-like with PHD and ring finger domains 1; Ubiquitin-like; containing PHD and RING finger domains; 1; Ubiquitin-like-containing PHD and RING finger domains protein 1; UHRF1_HUMAN; ubiquitin-like with PHD and ring finger domains 1; anti-UHRF1 antibody

• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 793

• Applicable Applications for anti-UHRF1 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human UHRF1 (14-51aa HTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQ), different from the related mouse sequence by six amino acids, and from the related rat sequence by five amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of UHRF1 expression in MCF-7 whole cell lysates (lane 1) and U2OS whole cell lysates (lane 2). UHRF1 at 90KD was detected using rabbit anti- UHRF1 Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Immunohistochemistry (IHC)

(UHRF1 was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- UHRF1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

Related Product Information for anti-UHRF1 antibody

Description: Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase UHRF1(UHRF1) detection. Tested with WB, IHC-P in Human.

Background: Ubiquitin-like, containing PHD and RING finger domains, 1 is a protein which in humans is encoded by the UHRF1 gene. This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. It is regarded as a hub protein for the integration of epigenetic information. This gene is up-regulated in various cancers, and it is therefore considered to be a therapeutic target. Multiple transcript variants encoding different isoforms have been found for this gene. A related pseudogene exists on chromosome 12.

References

1. "Entrez Gene: UHRF1 ubiquitin-like, containing PHD and RING finger domains, 1". 2. Hopfner R, Mousli M, Jeltsch JM, Voulgaris A, Lutz Y, Marin C, Bellocq JP, Oudet P, Bronner C (Jan 2000)."ICBP90, a novel human CCAAT binding protein, involved in the regulation of topoisomerase IIalpha expression".Cancer Research 60 (1): 121-8.

NCBI and Uniprot Product Information

• NCBI GI #: 115430235
• NCBI GeneID: 29128
• NCBI Accession #: NP_001041666.1
• NCBI GenBank Nucleotide #: NM_001048201.2
• UniProt Accession #: Q96T88; Q2HIX7; Q8J022; Q9H6S6; Q9P115; Q9P1U7; A0JBR2; A8K024; B2RBA9
• Molecular Weight: 91,116 Da
• NCBI Official Full Name: E3 ubiquitin-protein ligase UHRF1 isoform 1
• NCBI Official Synonym Full Names: ubiquitin like with PHD and ring finger domains 1
• NCBI Official Symbol: UHRF1
• NCBI Official Synonym Symbols: Np95; hNP95; ICBP90; RNF106; TDRD22; hUHRF1; huNp95
• NCBI Protein Information: E3 ubiquitin-protein ligase UHRF1
• UniProt Protein Name: E3 ubiquitin-protein ligase UHRF1
• Protein Family: UHRF1-binding protein
• UniProt Gene Name: UHRF1
• UniProt Synonym Gene Names: ICBP90; NP95; RNF106; HuNp95; hNp95; hUHRF1
• UniProt Entry Name: UHRF1_HUMAN

NCBI Description

This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. It is regarded as a hub protein for the integration of epigenetic information. This gene is up-regulated in various cancers, and it is therefore considered to be a therapeutic target. Multiple transcript variants encoding different isoforms have been found for this gene. A related pseudogene exists on chromosome 12. [provided by RefSeq, Feb 2014]

Uniprot Description

UHRF1: Multidomain protein that acts as a key epigenetic regulator by bridging DNA methylation and chromatin modification. Specifically recognizes and binds hemimethylated DNA at replication forks via its YDG domain and recruits DNMT1 methyltransferase to ensure faithful propagation of the DNA methylation patterns through DNA replication. In addition to its role in maintenance of DNA methylation, also plays a key role in chromatin modification: through its tudor-like regions and PHD- type zinc fingers, specifically recognizes and binds histone H3 trimethylated at 'Lys-9' (H3K9me3) and unmethylated at 'Arg-2' (H3R2me0), respectively, and recruits chromatin proteins. Enriched in pericentric heterochromatin where it recruits different chromatin modifiers required for this chromatin replication. Also localizes to euchromatic regions where it negatively regulates transcription possibly by impacting DNA methylation and histone modifications. Has E3 ubiquitin-protein ligase activity by mediating the ubiquitination of target proteins such as histone H3 and PML. It is still unclear how E3 ubiquitin-protein ligase activity is related to its role in chromatin in vivo. May be involved in DNA repair. Defects in UHRF1 may be a cause of cancers. Overexpressed in many different forms of human cancers, including bladder, breast, cervical, colorectal and prostate cancers, as well as pancreatic adenocarcinomas, rhabdomyosarcomas and gliomas. Plays an important role in the correlation of histone modification and gene silencing in cancer progression. Expression is associated with a poor prognosis in patients with various cancers, suggesting that it participates in cancer progression. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; Ubiquitin conjugating system; DNA-binding; Ubiquitin ligase; EC 6.3.2.-; EC 6.3.2.19; Ligase

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: euchromatin; heterochromatin; nuclear chromatin; nuclear heterochromatin; nuclear matrix; nucleus; replication fork

Molecular Function: histone binding; identical protein binding; ligase activity; methyl-CpG binding; methylated histone residue binding; nucleosomal histone binding; protein binding; transcription factor activity; ubiquitin-protein ligase activity; zinc ion binding

Biological Process: cell cycle; cell proliferation; DNA repair; histone monoubiquitination; histone ubiquitination; maintenance of DNA methylation; negative regulation of transcription from RNA polymerase II promoter; positive regulation of cellular protein metabolic process; positive regulation of transcription from RNA polymerase II promoter; protein autoubiquitination; protein ubiquitination during ubiquitin-dependent protein catabolic process; transcription, DNA-dependent