Rabbit THRA Polyclonal Antibody | anti-THRA antibody

THRA antibody - middle region

Cat. Num. AAA3202288

• Gene Names: THRA; AR7; EAR7; ERBA; CHNG6; ERBA1; NR1A1; THRA1; THRA2; ERB-T-1; c-ERBA-1
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: THRA; Polyclonal Antibody; THRA antibody - middle region; anti-THRA antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: DQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVV
• Sequence Length: 490

• Applicable Applications for anti-THRA antibody: Western Blot (WB)
• Homology: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human THRA
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: THRASample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: MouseTarget Name: THRASample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-THRA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that THRA is expressed in Jurkat)

Western Blot (WB)

(WB Suggested Anti-THRA antibody Titration: 1 ug/mLSample Type: Human heart)

Related Product Information for anti-THRA antibody

This is a rabbit polyclonal antibody against THRA. It was validated on Western Blot

Target Description: The THRA gene encodes a protein that is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that the different receptors, while having certain extent of redundancy, may mediate different functions of thyroid hormone.

Product Categories/Family for anti-THRA antibody

Polyclonal; Transcription Factor; Cancer; Transcription Regulation; Transcription Regulation; Cell Biology; Developmental Biology; DNA/RNA/Protein Interactions; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 20127452
• NCBI GeneID: 7067
• NCBI Accession #: NP_003241
• NCBI GenBank Nucleotide #: NM_003250
• UniProt Accession #: P10827
• Molecular Weight: 55kDa
• NCBI Official Full Name: thyroid hormone receptor alpha isoform 2
• NCBI Official Synonym Full Names: thyroid hormone receptor alpha
• NCBI Official Symbol: THRA
• NCBI Official Synonym Symbols: AR7; EAR7; ERBA; CHNG6; ERBA1; NR1A1; THRA1; THRA2; ERB-T-1; c-ERBA-1
• NCBI Protein Information: thyroid hormone receptor alpha
• UniProt Protein Name: Thyroid hormone receptor alpha
• Protein Family: Thyroid hormone receptor
• UniProt Gene Name: THRA
• UniProt Synonym Gene Names: EAR7; ERBA1; NR1A1; THRA1; THRA2; EAR-7
• UniProt Entry Name: THA_HUMAN

NCBI Description

The protein encoded by this gene is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that the different receptors, while having certain extent of redundancy, may mediate different functions of thyroid hormone. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

TR-alpha: nuclear hormone receptor and transcription factor. High affinity receptor for triiodothyronine. Interacts with SRC-3 and NCOA6 coactivators, leading to a strong increase of transcription of target genes. Four splice variant isoforms have been described.

Protein type: DNA-binding; Transcription factor; Nuclear receptor

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: nucleoplasm; nucleus; cytosol

Molecular Function: protein domain specific binding; protein binding; zinc ion binding; chromatin DNA binding; sequence-specific DNA binding; TATA-binding protein binding; protein complex binding; steroid hormone receptor activity; thyroid hormone receptor activity; transcription factor activity; transcription factor binding

Biological Process: transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; negative regulation of transcriptional preinitiation complex assembly; cytoplasmic sequestering of transcription factor; ossification; intracellular receptor-mediated signaling pathway; hormone-mediated signaling; positive regulation of female receptivity; regulation of myeloid cell apoptosis; regulation of heart contraction; regulation of lipid catabolic process; regulation of transcription from RNA polymerase II promoter; learning and/or memory; female courtship behavior; thyroid gland development; erythrocyte differentiation; steroid hormone mediated signaling; gene expression; positive regulation of transcription from RNA polymerase II promoter; response to cold; negative regulation of transcription, DNA-dependent; cartilage condensation

Disease: Hypothyroidism, Congenital, Nongoitrous, 6