Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: THRASample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Rabbit THRA Polyclonal Antibody | anti-THRA antibody

THRA antibody - middle region

Gene Names
THRA; AR7; EAR7; ERBA; CHNG6; ERBA1; NR1A1; THRA1; THRA2; ERB-T-1; c-ERBA-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
THRA; Polyclonal Antibody; THRA antibody - middle region; anti-THRA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVV
Sequence Length
490
Applicable Applications for anti-THRA antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human THRA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: THRASample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: THRASample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: MouseTarget Name: THRASample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: THRASample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-THRA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that THRA is expressed in Jurkat)

Western Blot (WB) (WB Suggested Anti-THRA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that THRA is expressed in Jurkat)

Western Blot (WB)

(WB Suggested Anti-THRA antibody Titration: 1 ug/mLSample Type: Human heart)

Western Blot (WB) (WB Suggested Anti-THRA antibody Titration: 1 ug/mLSample Type: Human heart)
Related Product Information for anti-THRA antibody
This is a rabbit polyclonal antibody against THRA. It was validated on Western Blot

Target Description: The THRA gene encodes a protein that is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that the different receptors, while having certain extent of redundancy, may mediate different functions of thyroid hormone.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
thyroid hormone receptor alpha isoform 2
NCBI Official Synonym Full Names
thyroid hormone receptor alpha
NCBI Official Symbol
THRA
NCBI Official Synonym Symbols
AR7; EAR7; ERBA; CHNG6; ERBA1; NR1A1; THRA1; THRA2; ERB-T-1; c-ERBA-1
NCBI Protein Information
thyroid hormone receptor alpha
UniProt Protein Name
Thyroid hormone receptor alpha
Protein Family
UniProt Gene Name
THRA
UniProt Synonym Gene Names
EAR7; ERBA1; NR1A1; THRA1; THRA2; EAR-7
UniProt Entry Name
THA_HUMAN

NCBI Description

The protein encoded by this gene is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that the different receptors, while having certain extent of redundancy, may mediate different functions of thyroid hormone. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

TR-alpha: nuclear hormone receptor and transcription factor. High affinity receptor for triiodothyronine. Interacts with SRC-3 and NCOA6 coactivators, leading to a strong increase of transcription of target genes. Four splice variant isoforms have been described.

Protein type: DNA-binding; Transcription factor; Nuclear receptor

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: nucleoplasm; nucleus; cytosol

Molecular Function: protein domain specific binding; protein binding; zinc ion binding; chromatin DNA binding; sequence-specific DNA binding; TATA-binding protein binding; protein complex binding; steroid hormone receptor activity; thyroid hormone receptor activity; transcription factor activity; transcription factor binding

Biological Process: transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; negative regulation of transcriptional preinitiation complex assembly; cytoplasmic sequestering of transcription factor; ossification; intracellular receptor-mediated signaling pathway; hormone-mediated signaling; positive regulation of female receptivity; regulation of myeloid cell apoptosis; regulation of heart contraction; regulation of lipid catabolic process; regulation of transcription from RNA polymerase II promoter; learning and/or memory; female courtship behavior; thyroid gland development; erythrocyte differentiation; steroid hormone mediated signaling; gene expression; positive regulation of transcription from RNA polymerase II promoter; response to cold; negative regulation of transcription, DNA-dependent; cartilage condensation

Disease: Hypothyroidism, Congenital, Nongoitrous, 6

Research Articles on THRA

Similar Products

Product Notes

The THRA thra (Catalog #AAA3202288) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The THRA antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's THRA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the THRA thra for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DQIILLKGCC MEIMSLRAAV RYDPESDTLT LSGEMAVKRE QLKNGGLGVV. It is sometimes possible for the material contained within the vial of "THRA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.