Mouse anti-Human THEG Polyclonal Antibody | anti-THEG antibody

THEG (Testicular Haploid Expressed Gene Protein, Cancer/testis Antigen 56, CT56)

Cat. Num. AAA644815

• Gene Names: THEG; CT56; THEG1
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: THEG; Polyclonal Antibody; THEG (Testicular Haploid Expressed Gene Protein; Cancer/testis Antigen 56; CT56); Anti -THEG (Testicular Haploid Expressed Gene Protein; anti-THEG antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human THEG.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MGDSRRRSLGNQPSSEAAGRSEREQDGDPRGLQSSVYESRRVTDPERQDLDNAELGPEDPEEELPPEEVAGEEFPETLDPKEALSELERVLDKDLEEDIPEISRLSISQKLPSTTMTKARKRRRRRRLMELAEPKINWQVLKDRKGRCGKGYAWISPCKMSLHFCLCWPSVYWTERFLEDTTLTITVPAVSRRVEELSRPKRFYLEYYNNNRTTPVWPIPRSSLEYRASSRLKELAAPKIRDNFWSMPMSEVSQVSRAAQMAVPSSRILQLSKPKAPATLLEEWDPVPKPKPHVSDHNRLLHLARPKAQSDKCVPDRDPRWEVLDVTKKVVASPRIISLAKPKVRKGLNEGYDRRPLASMSLPPPKASPEKCDQPRPGL

• Applicable Applications for anti-THEG antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human THEG, aa1-380 (AAH28574).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of THEG expression in transfected 293T cell line by THEG polyclonal antibody. Lane 1: THEG transfected lysate (41.8kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-THEG antibody

Antibodies; Abs to Spermatogenesis; Testis Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 7706121
• NCBI GeneID: 51298
• NCBI Accession #: NP_057669.1
• NCBI GenBank Nucleotide #: NM_016585.4
• UniProt Accession #: Q9P2T0; A6NMJ8
• Molecular Weight: 43,444 Da
• NCBI Official Full Name: testicular haploid expressed gene protein isoform 1
• NCBI Official Synonym Full Names: theg spermatid protein
• NCBI Official Symbol: THEG
• NCBI Official Synonym Symbols: CT56; THEG1
• NCBI Protein Information: testicular haploid expressed gene protein; Theg homolog; testis-specific; cancer/testis antigen 56
• UniProt Protein Name: Testicular haploid expressed gene protein
• Protein Family: Testicular haploid expressed gene protein
• UniProt Gene Name: THEG
• UniProt Synonym Gene Names: CT56
• UniProt Entry Name: THEG_HUMAN

NCBI Description

This gene is specifically expressed in the nucleus of haploid male germ cells. The orthologous gene in mice encodes a protein that may play a role in protein assembly through interactions with T-complex protein 1 subunit epsilon. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011]

Uniprot Description

THEG: May be involved (but not essential) in spermatogenesis. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cancer Testis Antigen (CTA)

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: nucleus

Molecular Function: protein binding

Biological Process: multicellular organismal development; spermatogenesis; chaperone-mediated protein complex assembly; cell differentiation