Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (UBL7 polyclonal antibody. Western Blot analysis of UBL7 expression in human pancreas.)

Mouse anti-Human UBL7 Polyclonal Antibody | anti-UBL7 antibody

UBL7 (Ubiquitin-like Protein 7, Bone Marrow Stromal Cell Ubiquitin-like Protein, BMSCUBP, BMSC-UbP, SB132, TCBA1, Ubiquitin-like Protein SB132)

Gene Names
UBL7; TCBA1; BMSC-UbP
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
UBL7; Polyclonal Antibody; UBL7 (Ubiquitin-like Protein 7; Bone Marrow Stromal Cell Ubiquitin-like Protein; BMSCUBP; BMSC-UbP; SB132; TCBA1; Ubiquitin-like Protein SB132); Anti -UBL7 (Ubiquitin-like Protein 7; anti-UBL7 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human UBL7.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSLSDWHLAVKLADQPLTPKSILRLPETELGEYSLGGYSISFLKQLIAGKLQESVPDPELIDLIYCGRKLKDDQTLDFYGIQPGSTVHVLRKSWPEPDQKPEPVDKVAAMREFRVLHTALHSSSSYREAVFKMLSNKESLDQIIVATPGLSSDPIALGVLQDKDLFSVFADPNMLDTLVPAHPALVNAIVLVLHSVAGSAPMPGTDSSSRSMPSSSYRDMPGGFLFEGLSDDEDDFHPNTRSTPSSSTPSSRPASLGYSGAAGPRPITQSELATALALASTPESSSHTPTPGTQGHSSGTSPMSSGVQSGTPITNDLFSQALQHALQASGQPSLQSQWQPQLQQLRDMGIQDDELSLRALQATGGDIQAALELIFAGGAP
Applicable Applications for anti-UBL7 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human UBL7, aa1-380 (NP_116296.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(UBL7 polyclonal antibody. Western Blot analysis of UBL7 expression in human pancreas.)

Western Blot (WB) (UBL7 polyclonal antibody. Western Blot analysis of UBL7 expression in human pancreas.)

Western Blot (WB)

(Western Blot analysis of UBL7 expression in transfected 293T cell line by UBL7 polyclonal antibody. Lane 1: UBL7 transfected lysate (41.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of UBL7 expression in transfected 293T cell line by UBL7 polyclonal antibody. Lane 1: UBL7 transfected lysate (41.8kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-UBL7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
40,510 Da
NCBI Official Full Name
UBL7 protein
NCBI Official Synonym Full Names
ubiquitin-like 7 (bone marrow stromal cell-derived)
NCBI Official Symbol
UBL7
NCBI Official Synonym Symbols
TCBA1; BMSC-UbP
NCBI Protein Information
ubiquitin-like protein 7; ubiquitin-like protein SB132; bone marrow stromal cell ubiquitin-like protein
UniProt Protein Name
Ubiquitin-like protein 7
Protein Family
UniProt Gene Name
UBL7
UniProt Synonym Gene Names
BMSCUBP; BMSC-UbP
UniProt Entry Name
UBL7_HUMAN

Uniprot Description

UBL7: Down-regulated by PMA in bone marrow stroma cells. Binds ubiquitin.

Protein type: Ubiquitin-like modifier

Chromosomal Location of Human Ortholog: 15q24.1

Research Articles on UBL7

Similar Products

Product Notes

The UBL7 ubl7 (Catalog #AAA6002813) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UBL7 (Ubiquitin-like Protein 7, Bone Marrow Stromal Cell Ubiquitin-like Protein, BMSCUBP, BMSC-UbP, SB132, TCBA1, Ubiquitin-like Protein SB132) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBL7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the UBL7 ubl7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSLSDWHLAV KLADQPLTPK SILRLPETEL GEYSLGGYSI SFLKQLIAGK LQESVPDPEL IDLIYCGRKL KDDQTLDFYG IQPGSTVHVL RKSWPEPDQK PEPVDKVAAM REFRVLHTAL HSSSSYREAV FKMLSNKESL DQIIVATPGL SSDPIALGVL QDKDLFSVFA DPNMLDTLVP AHPALVNAIV LVLHSVAGSA PMPGTDSSSR SMPSSSYRDM PGGFLFEGLS DDEDDFHPNT RSTPSSSTPS SRPASLGYSG AAGPRPITQS ELATALALAS TPESSSHTPT PGTQGHSSGT SPMSSGVQSG TPITNDLFSQ ALQHALQASG QPSLQSQWQP QLQQLRDMGI QDDELSLRAL QATGGDIQAA LELIFAGGAP. It is sometimes possible for the material contained within the vial of "UBL7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.