Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: THBS3Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human THBS3 Polyclonal Antibody | anti-THBS3 antibody

THBS3 Antibody - middle region

Gene Names
THBS3; TSP3
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
THBS3; Polyclonal Antibody; THBS3 Antibody - middle region; anti-THBS3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CRLFPNKDQQNSDTDSFGDACDNCPNVPNNDQKDTDGNGEGDACDNDVDG
Sequence Length
167
Applicable Applications for anti-THBS3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human THBS3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: THBS3Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: THBS3Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-THBS3 antibody
The protein encoded by this gene belongs to the thrombospondin family. Thrombospondin family members are adhesive glycoproteins that mediate cell-to-cell and cell-to-matrix interactions. This protein forms a pentameric molecule linked by a single disulfide bond. This gene shares a common promoter with metaxin 1. Alternate splicing results in coding and non-coding transcript variants.
Product Categories/Family for anti-THBS3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
104 kDa
NCBI Official Full Name
thrombospondin-3 isoform 2
NCBI Official Synonym Full Names
thrombospondin 3
NCBI Official Symbol
THBS3
NCBI Official Synonym Symbols
TSP3
NCBI Protein Information
thrombospondin-3
UniProt Protein Name
Thrombospondin-3
Protein Family
UniProt Gene Name
THBS3
UniProt Synonym Gene Names
TSP3
UniProt Entry Name
TSP3_HUMAN

NCBI Description

The protein encoded by this gene belongs to the thrombospondin family. Thrombospondin family members are adhesive glycoproteins that mediate cell-to-cell and cell-to-matrix interactions. This protein forms a pentameric molecule linked by a single disulfide bond. This gene shares a common promoter with metaxin 1. Alternate splicing results in coding and non-coding transcript variants. [provided by RefSeq, Nov 2011]

Uniprot Description

THBS3: Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Can bind to fibrinogen, fibronectin, laminin and type V collagen. Belongs to the thrombospondin family.

Protein type: Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: perinuclear region of cytoplasm; extracellular region

Molecular Function: heparin binding; calcium ion binding

Biological Process: cell-matrix adhesion

Research Articles on THBS3

Similar Products

Product Notes

The THBS3 thbs3 (Catalog #AAA3220434) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The THBS3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's THBS3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the THBS3 thbs3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CRLFPNKDQQ NSDTDSFGDA CDNCPNVPNN DQKDTDGNGE GDACDNDVDG. It is sometimes possible for the material contained within the vial of "THBS3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.