Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: THBS1Sample Tissue: Human Lung TumorAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human THBS1 Polyclonal Antibody | anti-THBS1 antibody

THBS1 Antibody - middle region

Gene Names
THBS1; TSP; THBS; TSP1; TSP-1; THBS-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
THBS1; Polyclonal Antibody; THBS1 Antibody - middle region; anti-THBS1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NATYHCKKDNCPNLPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFH
Sequence Length
1170
Applicable Applications for anti-THBS1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human THBS1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: THBS1Sample Tissue: Human Lung TumorAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: THBS1Sample Tissue: Human Lung TumorAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-THBS1 antibody
The protein encoded by this gene is a subunit of a disulfide-linked homotrimeric protein. This protein is an adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. This protein can bind to fibrinogen, fibronectin, laminin, type V collagen and integrins alpha-V/beta-1. This protein has been shown to play roles in platelet aggregation, angiogenesis, and tumorigenesis.
Product Categories/Family for anti-THBS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
129 kDa
NCBI Official Full Name
thrombospondin-1
NCBI Official Synonym Full Names
thrombospondin 1
NCBI Official Symbol
THBS1
NCBI Official Synonym Symbols
TSP; THBS; TSP1; TSP-1; THBS-1
NCBI Protein Information
thrombospondin-1
UniProt Protein Name
Thrombospondin-1
Protein Family
UniProt Gene Name
THBS1
UniProt Synonym Gene Names
TSP; TSP1
UniProt Entry Name
TSP1_HUMAN

NCBI Description

The protein encoded by this gene is a subunit of a disulfide-linked homotrimeric protein. This protein is an adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. This protein can bind to fibrinogen, fibronectin, laminin, type V collagen and integrins alpha-V/beta-1. This protein has been shown to play roles in platelet aggregation, angiogenesis, and tumorigenesis. [provided by RefSeq, Jul 2008]

Uniprot Description

THBS1: Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Binds heparin. May play a role in dentinogenesis and/or maintenance of dentin and dental pulp. Ligand for CD36 mediating antiangiogenic properties. Belongs to the thrombospondin family.

Protein type: Motility/polarity/chemotaxis; Inhibitor

Chromosomal Location of Human Ortholog: 15q15

Cellular Component: extracellular matrix; extracellular space; cell surface; sarcoplasmic reticulum; endoplasmic reticulum; endoplasmic reticulum lumen; fibrinogen complex; extracellular region; external side of plasma membrane; secretory granule

Molecular Function: heparin binding; identical protein binding; laminin binding; calcium ion binding; integrin binding; protein binding; proteoglycan binding; fibroblast growth factor binding; phosphatidylserine binding; transforming growth factor beta binding; fibronectin binding; low-density lipoprotein binding; glycoprotein binding

Biological Process: extracellular matrix organization and biogenesis; activation of MAPK activity; response to magnesium ion; negative regulation of fibrinolysis; response to glucose stimulus; cell adhesion; cell cycle arrest; positive regulation of macrophage activation; response to drug; platelet activation; negative regulation of interleukin-12 production; positive regulation of chemotaxis; positive regulation of blood vessel endothelial cell migration; response to testosterone stimulus; negative regulation of cell-matrix adhesion; negative regulation of blood vessel endothelial cell migration; response to unfolded protein; positive regulation of angiogenesis; response to mechanical stimulus; negative regulation of endothelial cell proliferation; regulation of cGMP metabolic process; peptide cross-linking; response to calcium ion; response to progesterone stimulus; negative regulation of apoptosis; positive regulation of blood coagulation; positive regulation of translation; negative regulation of fibroblast growth factor receptor signaling pathway; negative regulation of antigen processing and presentation of peptide or polysaccharide antigen via MHC class II; negative regulation of caspase activity; behavioral response to pain; platelet degranulation; positive regulation of tumor necrosis factor biosynthetic process; protein amino acid O-linked glycosylation; positive regulation of transforming growth factor-beta1 production; cell migration; chronic inflammatory response; negative regulation of focal adhesion formation; positive regulation of transforming growth factor beta receptor signaling pathway; engulfment of apoptotic cell; post-translational protein modification; positive regulation of protein kinase B signaling cascade; negative regulation of angiogenesis; cellular protein metabolic process; negative regulation of dendritic cell antigen processing and presentation; response to hypoxia; immune response; sprouting angiogenesis; blood coagulation; positive regulation of phosphorylation; positive regulation of cell migration

Research Articles on THBS1

Similar Products

Product Notes

The THBS1 thbs1 (Catalog #AAA3220744) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The THBS1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's THBS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the THBS1 thbs1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NATYHCKKDN CPNLPNSGQE DYDKDGIGDA CDDDDDNDKI PDDRDNCPFH. It is sometimes possible for the material contained within the vial of "THBS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.