Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Sample Type: Normal Human ProstateSample Type :Normal Human ProstatePrimary Antibody Dilution :2ug/mLColor/Signal Descriptions:TGM4 (DAB; brown), nuclei (hematoxylin; blue)Gene Name:TGM4)

Rabbit TGM4 Polyclonal Antibody | anti-TGM4 antibody

TGM4 antibody - N-terminal region

Gene Names
TGM4; TGP; hTGP
Reactivity
Guinea Pig, Human, Mouse, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
TGM4; Polyclonal Antibody; TGM4 antibody - N-terminal region; anti-TGM4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KEDMVFMPDEDERKEYILNDTGCHYVGAARSIKCKPWNFGQFEKNVLDCC
Sequence Length
684
Applicable Applications for anti-TGM4 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Guinea Pig: 75%; Human: 100%; Mouse: 83%; Rat: 75%; Zebrafish: 82%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TGM4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Sample Type: Normal Human ProstateSample Type :Normal Human ProstatePrimary Antibody Dilution :2ug/mLColor/Signal Descriptions:TGM4 (DAB; brown), nuclei (hematoxylin; blue)Gene Name:TGM4)

Immunohistochemistry (IHC) (Sample Type: Normal Human ProstateSample Type :Normal Human ProstatePrimary Antibody Dilution :2ug/mLColor/Signal Descriptions:TGM4 (DAB; brown), nuclei (hematoxylin; blue)Gene Name:TGM4)

Immunohistochemistry (IHC)

(Sample Type: Normal Human ProstateSample Type :Normal Human ProstatePrimary Antibody Dilution :2ug/mLColor/Signal Descriptions:TGM4 (DAB; brown), nuclei (hematoxylin; blue)Gene Name:TGM4)

Immunohistochemistry (IHC) (Sample Type: Normal Human ProstateSample Type :Normal Human ProstatePrimary Antibody Dilution :2ug/mLColor/Signal Descriptions:TGM4 (DAB; brown), nuclei (hematoxylin; blue)Gene Name:TGM4)

Immunohistochemistry (IHC)

(Sample Type: Normal Human Prostate.Primary Antibody Dilution: 2ug/mL.Color/Signal Descriptions: TGM4 (DAB; brown), nuclei (hematoxylin; blue)Gene Name: TGM4.)

Immunohistochemistry (IHC) (Sample Type: Normal Human Prostate.Primary Antibody Dilution: 2ug/mL.Color/Signal Descriptions: TGM4 (DAB; brown), nuclei (hematoxylin; blue)Gene Name: TGM4.)

Western Blot (WB)

(WB Suggested Anti-TGM4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysateTGM4 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells)

Western Blot (WB) (WB Suggested Anti-TGM4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysateTGM4 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells)
Related Product Information for anti-TGM4 antibody
This is a rabbit polyclonal antibody against TGM4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TGM4 is associated with the mammalian reproductive process. TGM4 catalyzes the cross-linking of proteins and the conjugation of polyamines to specific proteins in the seminal tract.
Product Categories/Family for anti-TGM4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77kDa
NCBI Official Full Name
protein-glutamine gamma-glutamyltransferase 4
NCBI Official Synonym Full Names
transglutaminase 4
NCBI Official Symbol
TGM4
NCBI Official Synonym Symbols
TGP; hTGP
NCBI Protein Information
protein-glutamine gamma-glutamyltransferase 4
UniProt Protein Name
Protein-glutamine gamma-glutamyltransferase 4
UniProt Gene Name
TGM4
UniProt Synonym Gene Names
TG(P); TGP; TGase P; TGase-4
UniProt Entry Name
TGM4_HUMAN

Uniprot Description

TGM4: Associated with the mammalian reproductive process. Catalyzes the cross-linking of proteins and the conjugation of polyamines to specific proteins in the seminal tract. Belongs to the transglutaminase superfamily. Transglutaminase family.

Protein type: Transferase; EC 2.3.2.13

Chromosomal Location of Human Ortholog: 3p22-p21.33

Cellular Component: extracellular matrix; Golgi apparatus; cytoplasm

Molecular Function: protein-glutamine gamma-glutamyltransferase activity; metal ion binding

Biological Process: peptide cross-linking; mating plug formation

Research Articles on TGM4

Similar Products

Product Notes

The TGM4 tgm4 (Catalog #AAA3206199) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TGM4 antibody - N-terminal region reacts with Guinea Pig, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TGM4 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the TGM4 tgm4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KEDMVFMPDE DERKEYILND TGCHYVGAAR SIKCKPWNFG QFEKNVLDCC. It is sometimes possible for the material contained within the vial of "TGM4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.