Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TGM5 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)

Rabbit TGM5 Polyclonal Antibody | anti-TGM5 antibody

TGM5 antibody - C-terminal region

Gene Names
TGM5; TGX; PSS2; TGM6; TGMX; TGASE5; TGASEX
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TGM5; Polyclonal Antibody; TGM5 antibody - C-terminal region; anti-TGM5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VLKPQHQASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL
Sequence Length
720
Applicable Applications for anti-TGM5 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 85%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TGM5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TGM5 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)

Western Blot (WB) (WB Suggested Anti-TGM5 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)
Related Product Information for anti-TGM5 antibody
This is a rabbit polyclonal antibody against TGM5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TGM5 belongs to the transglutaminase superfamily, transglutaminase family. It catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins. It contributes to the formation of the cornified cell envelope of keratinocytes. Defects in TGM5 are a cause of peeling skin syndrome acral type (APSS).
Product Categories/Family for anti-TGM5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
81kDa
NCBI Official Full Name
protein-glutamine gamma-glutamyltransferase 5 isoform 1
NCBI Official Synonym Full Names
transglutaminase 5
NCBI Official Symbol
TGM5
NCBI Official Synonym Symbols
TGX; PSS2; TGM6; TGMX; TGASE5; TGASEX
NCBI Protein Information
protein-glutamine gamma-glutamyltransferase 5
UniProt Protein Name
Protein-glutamine gamma-glutamyltransferase 5
UniProt Gene Name
TGM5
UniProt Synonym Gene Names
TGMX; TG(X); TGX; TGase X; TGase-5
UniProt Entry Name
TGM5_HUMAN

NCBI Description

This gene encodes a member of the transglutaminase family. The encoded protein catalyzes formation of protein cross-links between glutamine and lysine residues, often resulting in stabilization of protein assemblies. This reaction is calcium dependent. Mutations in this gene have been associated with acral peeling skin syndrome. [provided by RefSeq, Oct 2009]

Uniprot Description

TGM5: Catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins. Contributes to the formation of the cornified cell envelope of keratinocytes. Defects in TGM5 are a cause of peeling skin syndrome type A (APSS). A non-inflammatory form of peeling skin syndrome, a genodermatosis characterized by the continuous shedding of the outer layers of the epidermis. In APSS patients, skin peeling is strictly limited to the dorsa of the hands and feet, and it is accompanied by accompanied by painless erythema and spontaneous non-scarring healing. Ultrastructural and histological analysis shows a level of blistering high in the epidermis at the stratum granulosum-stratum corneum junction. Belongs to the transglutaminase superfamily. Transglutaminase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transferase; EC 2.3.2.13

Chromosomal Location of Human Ortholog: 15q15.2

Cellular Component: cytoplasm

Molecular Function: protein-glutamine gamma-glutamyltransferase activity; metal ion binding

Biological Process: epidermis development; protein modification process; peptide cross-linking

Disease: Peeling Skin Syndrome 2

Research Articles on TGM5

Similar Products

Product Notes

The TGM5 tgm5 (Catalog #AAA3209364) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TGM5 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TGM5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TGM5 tgm5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VLKPQHQASI ILETVPFKSG QRQIQANMRS NKFKDIKGYR NVYVDFAL. It is sometimes possible for the material contained within the vial of "TGM5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.