Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TGFBR3Sample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human TGFBR3 Polyclonal Antibody | anti-TGFBR3 antibody

TGFBR3 Antibody - middle region

Gene Names
TGFBR3; BGCAN; betaglycan
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TGFBR3; Polyclonal Antibody; TGFBR3 Antibody - middle region; anti-TGFBR3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PFPFPDISRRVWNEEGEDGLPRPKDPVIPSIQLFPGLREPEEVQGSVDIA
Sequence Length
851
Applicable Applications for anti-TGFBR3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of human TGFBR3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TGFBR3Sample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TGFBR3Sample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TGFBR3 antibody
This locus encodes the transforming growth factor (TGF)-beta type III receptor. The encoded receptor is a membrane proteoglycan that often functions as a co-receptor with other TGF-beta receptor superfamily members. Ectodomain shedding produces soluble TGFBR3, which may inhibit TGFB signaling. Decreased expression of this receptor has been observed in various cancers. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
Product Categories/Family for anti-TGFBR3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
93 kDa
NCBI Official Full Name
transforming growth factor beta receptor type 3 isoform b
NCBI Official Synonym Full Names
transforming growth factor beta receptor 3
NCBI Official Symbol
TGFBR3
NCBI Official Synonym Symbols
BGCAN; betaglycan
NCBI Protein Information
transforming growth factor beta receptor type 3
UniProt Protein Name
Transforming growth factor beta receptor type 3
UniProt Gene Name
TGFBR3
UniProt Synonym Gene Names
TGF-beta receptor type 3; TGFR-3
UniProt Entry Name
TGBR3_HUMAN

NCBI Description

This locus encodes the transforming growth factor (TGF)-beta type III receptor. The encoded receptor is a membrane proteoglycan that often functions as a co-receptor with other TGF-beta receptor superfamily members. Ectodomain shedding produces soluble TGFBR3, which may inhibit TGFB signaling. Decreased expression of this receptor has been observed in various cancers. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.[provided by RefSeq, Sep 2010]

Uniprot Description

TGFBR3: Binds to TGF-beta. Could be involved in capturing and retaining TGF-beta for presentation to the signaling receptors. Interacts with TCTEX1D4. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p33-p32

Cellular Component: proteinaceous extracellular matrix; extracellular space; cell surface; integral to plasma membrane; endoplasmic reticulum; receptor complex; external side of plasma membrane

Molecular Function: heparin binding; transforming growth factor beta receptor activity; protein binding; glycosaminoglycan binding; fibroblast growth factor binding; transforming growth factor beta binding; punt binding; activin binding; coreceptor activity; SMAD binding; transforming growth factor beta receptor binding; PDZ domain binding

Biological Process: transforming growth factor beta receptor complex assembly; heart morphogenesis; blood vessel development; cell migration; blastocyst development; organ regeneration; positive regulation of transforming growth factor beta receptor signaling pathway; negative regulation of cell motility; cardiac muscle cell proliferation; palate development; liver development; activation of NF-kappaB transcription factor; BMP signaling pathway; transforming growth factor beta receptor signaling pathway; regulation of protein binding; response to hypoxia; ventricular cardiac muscle morphogenesis; epithelial to mesenchymal transition; immune response; negative regulation of transforming growth factor beta receptor signaling pathway; cell growth; response to follicle-stimulating hormone stimulus; negative regulation of epithelial cell proliferation

Research Articles on TGFBR3

Similar Products

Product Notes

The TGFBR3 tgfbr3 (Catalog #AAA3221451) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TGFBR3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TGFBR3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TGFBR3 tgfbr3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PFPFPDISRR VWNEEGEDGL PRPKDPVIPS IQLFPGLREP EEVQGSVDIA. It is sometimes possible for the material contained within the vial of "TGFBR3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.