Immunofluorescence (IF)
(Species, Tissue/Cell Type:Human Cornea tissue (epithelium and stroma)Primary used and dilution: 1:400)
Rabbit TGFBI Polyclonal Antibody | anti-TGFBI antibody
TGFBI antibody - C-terminal region
Gene Names
TGFBI; CSD; CDB1; CDG2; CSD1; CSD2; CSD3; EBMD; LCD1; BIGH3; CDGG1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunofluorescence, Western Blot
Purity
Protein A purified
Synonyms
TGFBI; Polyclonal Antibody; TGFBI antibody - C-terminal region; anti-TGFBI antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA
Sequence Length
416
Applicable Applications for anti-TGFBI antibody
Immunofluorescence (IF), Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TGFBI
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunofluorescence (IF)
(Species, Tissue/Cell Type:Human Cornea tissue (epithelium and stroma)Primary used and dilution: 1:400)
Immunofluorescence (IF)
(Species, Tissue/Cell Type:Human Cornea tissue (epithelium and stroma)Primary used and dilution: 1:400)
Western Blot (WB)
(Host: RabbitTarget Name: TGFBISample Type: JurkatLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2.5ug/mLPeptide Concentration: 2.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%)
Western Blot (WB)
(Host: RabbitTarget Name: TGFBISample Type: JurkatLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2.5ug/mLPeptide Concentration: 2.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%)
Western Blot (WB)
(WB Suggested Anti-TGFBI Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-TGFBI Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-TGFBI antibody
This is a rabbit polyclonal antibody against TGFBI. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: TGFBI Binds to type I, II, and IV collagens. This adhesion protein may play an important role in cell-collagen interactions. In cartilage, may be involved in endochondral bone formation.
Target Description: TGFBI Binds to type I, II, and IV collagens. This adhesion protein may play an important role in cell-collagen interactions. In cartilage, may be involved in endochondral bone formation.
Product Categories/Family for anti-TGFBI antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
transforming growth factor-beta-induced protein ig-h3
NCBI Official Synonym Full Names
transforming growth factor beta induced
NCBI Official Symbol
TGFBI
NCBI Official Synonym Symbols
CSD; CDB1; CDG2; CSD1; CSD2; CSD3; EBMD; LCD1; BIGH3; CDGG1
NCBI Protein Information
transforming growth factor-beta-induced protein ig-h3
UniProt Protein Name
Transforming growth factor-beta-induced protein ig-h3
Protein Family
UniProt Gene Name
TGFBI
UniProt Synonym Gene Names
BIGH3; Beta ig-h3; RGD-CAP
UniProt Entry Name
BGH3_HUMAN
NCBI Description
This gene encodes an RGD-containing protein that binds to type I, II and IV collagens. The RGD motif is found in many extracellular matrix proteins modulating cell adhesion and serves as a ligand recognition sequence for several integrins. This protein plays a role in cell-collagen interactions and may be involved in endochondrial bone formation in cartilage. The protein is induced by transforming growth factor-beta and acts to inhibit cell adhesion. Mutations in this gene are associated with multiple types of corneal dystrophy. [provided by RefSeq, Jul 2008]
Research Articles on TGFBI
Similar Products
Product Notes
The TGFBI tgfbi (Catalog #AAA3207288) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TGFBI antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TGFBI can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Researchers should empirically determine the suitability of the TGFBI tgfbi for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LKNNVVSVNK EPVAEPDIMA TNGVVHVITN VLQPPANRPQ ERGDELADSA. It is sometimes possible for the material contained within the vial of "TGFBI, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
