Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TFPI rabbit polyclonal antibody. Western Blot analysis of TFPI expression in mouse liver.)

Rabbit anti-Human, Mouse TFPI Polyclonal Antibody | anti-TFPI antibody

TFPI (Tissue Factor Pathway Inhibitor, TFI, TFPI 1, TFPI1, Extrinsic Pathway Inhibitor, EPI, Lipoprotein-associated Coagulation Inhibitor, LACI) (HRP)

Gene Names
TFPI; EPI; TFI; LACI; TFPI1
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TFPI; Polyclonal Antibody; TFPI (Tissue Factor Pathway Inhibitor; TFI; TFPI 1; TFPI1; Extrinsic Pathway Inhibitor; EPI; Lipoprotein-associated Coagulation Inhibitor; LACI) (HRP); anti-TFPI antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TFPI. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-TFPI antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TFPI, aa1-304 (NP_006278.1).
Immunogen Sequence
MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TFPI rabbit polyclonal antibody. Western Blot analysis of TFPI expression in mouse liver.)

Western Blot (WB) (TFPI rabbit polyclonal antibody. Western Blot analysis of TFPI expression in mouse liver.)

Western Blot (WB)

(Western Blot analysis of TFPI expression in transfected 293T cell line by TFPI polyclonal antibody. Lane 1: TFPI transfected lysate (35kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TFPI expression in transfected 293T cell line by TFPI polyclonal antibody. Lane 1: TFPI transfected lysate (35kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-TFPI antibody
TFPI is also known as lipoprotein-associated coagulation inhibitor (LACI). TFPI encodes a protease inhibitor that regulates the tissue factor (TF)-dependent pathway of blood coagulation. The coagulation process initiates the formation of factor VIIa-TF complex, which proteolytically activates additional proteases and this leads to the formation of a fibrin clot. The encoded protein is glycosylated and primarily found in the vascular endothelium and plasma.
Product Categories/Family for anti-TFPI antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,653 Da
NCBI Official Full Name
tissue factor pathway inhibitor isoform a
NCBI Official Synonym Full Names
tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor)
NCBI Official Symbol
TFPI
NCBI Official Synonym Symbols
EPI; TFI; LACI; TFPI1
NCBI Protein Information
tissue factor pathway inhibitor; anti-convertin; extrinsic pathway inhibitor
UniProt Protein Name
Tissue factor pathway inhibitor
UniProt Gene Name
TFPI
UniProt Synonym Gene Names
LACI; TFPI1; TFPI; EPI; LACI
UniProt Entry Name
TFPI1_HUMAN

NCBI Description

This gene encodes a protease inhibitor that regulates the tissue factor (TF)-dependent pathway of blood coagulation. The coagulation process initiates with the formation of a factor VIIa-TF complex, which proteolytically activates additional proteases (factors IX and X) and ultimately leads to the formation of a fibrin clot. The product of this gene inhibits the activated factor X and VIIa-TF proteases in an autoregulatory loop. The encoded protein is glycosylated and predominantly found in the vascular endothelium and plasma in both free forms and complexed with plasma lipoproteins. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been confirmed. [provided by RefSeq, Jul 2008]

Uniprot Description

TFPI: Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Membrane protein, GPI anchor; Secreted, signal peptide; Inhibitor

Chromosomal Location of Human Ortholog: 2q32

Cellular Component: extracellular space; cell surface; endoplasmic reticulum; extracellular region; plasma membrane

Molecular Function: serine-type endopeptidase inhibitor activity; endopeptidase inhibitor activity

Biological Process: blood coagulation, extrinsic pathway; blood coagulation

Research Articles on TFPI

Similar Products

Product Notes

The TFPI tfpi (Catalog #AAA6396350) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TFPI (Tissue Factor Pathway Inhibitor, TFI, TFPI 1, TFPI1, Extrinsic Pathway Inhibitor, EPI, Lipoprotein-associated Coagulation Inhibitor, LACI) (HRP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TFPI can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TFPI tfpi for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TFPI, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.