Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Tetraspanin 2 antibody (MBS5302996) used at 1 ug/ml to detect target protein.)

Rabbit Tetraspanin 2 Polyclonal Antibody | anti-TSPAN2 antibody

Tetraspanin 2 antibody

Gene Names
TSPAN2; NET3; TSN2; TSPAN-2
Applications
Western Blot
Purity
Affinity purified
Synonyms
Tetraspanin 2; Polyclonal Antibody; Tetraspanin 2 antibody; Polyclonal Tetraspanin 2; Anti-Tetraspanin 2; FLJ12082; 6330415F13Rik; Tetraspanin -2; TSPAN-2; TSN2; RP4-666F24.2; TSPAN2; anti-TSPAN2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
Tetraspanin 2 antibody was raised against the middle region of TSPAN2
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TSPAN2 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
196
Applicable Applications for anti-TSPAN2 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
TSPAN2 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.
Cross-Reactivity
Human
Immunogen
Tetraspanin 2 antibody was raised using the middle region of TSPAN2 corresponding to a region with amino acids FAFIGKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESS
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Tetraspanin 2 antibody (MBS5302996) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Tetraspanin 2 antibody (MBS5302996) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-TSPAN2 antibody
Rabbit polyclonal Tetraspanin 2 antibody raised against the middle region of TSPAN2
Product Categories/Family for anti-TSPAN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24 kDa (MW of target protein)
NCBI Official Full Name
tetraspanin-2 isoform 2
NCBI Official Synonym Full Names
tetraspanin 2
NCBI Official Symbol
TSPAN2
NCBI Official Synonym Symbols
NET3; TSN2; TSPAN-2
NCBI Protein Information
tetraspanin-2
UniProt Protein Name
Tetraspanin-2
UniProt Gene Name
TSPAN2
UniProt Synonym Gene Names
Tspan-2
UniProt Entry Name
TSN2_HUMAN

NCBI Description

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2015]

Uniprot Description

TSPAN2: May play a role in signalling in oligodendrocytes in the early stages of their terminal differentiation into myelin-forming glia and may also function in stabilizing the mature sheath. Belongs to the tetraspanin (TM4SF) family.

Protein type: Motility/polarity/chemotaxis; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p13.2

Cellular Component: integral to membrane; plasma membrane; myelin sheath

Biological Process: myelination; microglia development; oligodendrocyte differentiation; brain development; inflammatory response; astrocyte development

Research Articles on TSPAN2

Similar Products

Product Notes

The TSPAN2 tspan2 (Catalog #AAA5302996) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Tetraspanin 2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the TSPAN2 tspan2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Tetraspanin 2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.