Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of TEAD4 expression in transfected 293T cell line by TEAD4 polyclonal antibody. Lane 1: TEAD4 transfected lysate (34.2kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human TEAD4 Polyclonal Antibody | anti-TEAD4 antibody

TEAD4 (Transcriptional Enhancer Factor TEF-3, TEA Domain Family Member 4, TEAD-4, Transcription Factor RTEF-1, Transcription Factor 13-like 1, RTEF1, TCF13L1, TEF3, MGC9014) (PE)

Gene Names
TEAD4; TEF3; RTEF1; TEF-3; EFTR-2; TEFR-1; TCF13L1; hRTEF-1B
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TEAD4; Polyclonal Antibody; TEAD4 (Transcriptional Enhancer Factor TEF-3; TEA Domain Family Member 4; TEAD-4; Transcription Factor RTEF-1; Transcription Factor 13-like 1; RTEF1; TCF13L1; TEF3; MGC9014) (PE); anti-TEAD4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TEAD4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-TEAD4 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TEAD4, aa1-305 (NP_958851.1).
Immunogen Sequence
MAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TEAD4 expression in transfected 293T cell line by TEAD4 polyclonal antibody. Lane 1: TEAD4 transfected lysate (34.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TEAD4 expression in transfected 293T cell line by TEAD4 polyclonal antibody. Lane 1: TEAD4 transfected lysate (34.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-TEAD4 antibody
TEAD4 is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene.
Product Categories/Family for anti-TEAD4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,329 Da
NCBI Official Full Name
transcriptional enhancer factor TEF-3 isoform 3
NCBI Official Synonym Full Names
TEA domain family member 4
NCBI Official Symbol
TEAD4
NCBI Official Synonym Symbols
TEF3; RTEF1; TEF-3; EFTR-2; TEFR-1; TCF13L1; hRTEF-1B
NCBI Protein Information
transcriptional enhancer factor TEF-3; transcription factor RTEF-1; transcription factor 13-like 1; transcriptional enhancer factor 3; related transcription enhancer factor 1B; transcriptional enhancer factor 1-related
UniProt Protein Name
Transcriptional enhancer factor TEF-3
UniProt Gene Name
TEAD4
UniProt Synonym Gene Names
RTEF1; TCF13L1; TEF3; TEAD-4
UniProt Entry Name
TEAD4_HUMAN

NCBI Description

This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

TEAD4: Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration and epithelial mesenchymal transition (EMT) induction. Binds specifically and non-cooperatively to the Sph and GT-IIC 'enhansons' (5'-GTGGAATGT-3') and activates transcription. Binds to the M-CAT motif. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 12p13.3-p13.2

Cellular Component: nucleoplasm

Molecular Function: protein binding; DNA binding; transcription factor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; muscle development; gene expression; skeletal development

Research Articles on TEAD4

Similar Products

Product Notes

The TEAD4 tead4 (Catalog #AAA6396279) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TEAD4 (Transcriptional Enhancer Factor TEF-3, TEA Domain Family Member 4, TEAD-4, Transcription Factor RTEF-1, Transcription Factor 13-like 1, RTEF1, TCF13L1, TEF3, MGC9014) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TEAD4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TEAD4 tead4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TEAD4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.