Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MESDC2 polyclonal antibody. Western Blot analysis of MESDC2 expression in human liver.)

Mouse anti-Human MESDC2 Polyclonal Antibody | anti-MESDC2 antibody

MESDC2 (KIAA0081, MESD, LDLR Chaperone MESD, Mesoderm Development Candidate 2, Mesoderm Development Protein, Renal Carcinoma Antigen NY-REN-61)

Gene Names
MESDC2; BOCA; MESD
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
MESDC2; Polyclonal Antibody; MESDC2 (KIAA0081; MESD; LDLR Chaperone MESD; Mesoderm Development Candidate 2; Mesoderm Development Protein; Renal Carcinoma Antigen NY-REN-61); Anti -MESDC2 (KIAA0081; anti-MESDC2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MESDC2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAASRWARKAVVLLCASDLLLLLLLLPPPGSCAAEGSPGTPDESTPPPRKKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPVDFSKIDPSKPESILKMTKKGKTLMMFVTVSGSPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVGQDRCADVTLEGQVYPGKGGGSKEKNKTKQDKGKKKKEGDLKSRSSKEENRAGNKREDL
Applicable Applications for anti-MESDC2 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human MESDC2, aa1-234 (NP_055969.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(MESDC2 polyclonal antibody. Western Blot analysis of MESDC2 expression in human liver.)

Western Blot (WB) (MESDC2 polyclonal antibody. Western Blot analysis of MESDC2 expression in human liver.)

Western Blot (WB)

(Western Blot analysis of MESDC2 expression in transfected 293T cell line by MESDC2 polyclonal antibody. Lane 1: MESDC2 transfected lysate (25.74kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MESDC2 expression in transfected 293T cell line by MESDC2 polyclonal antibody. Lane 1: MESDC2 transfected lysate (25.74kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-MESDC2 antibody
Chaperone specifically assisting the folding of beta-propeller/EGF modules within the family of low-density lipoprotein receptors (LDLRs). Acts as a modulator of the Wnt pathway through chaperoning the coreceptors of the canonical Wnt pathway, LRP5 and LRP6, to the plasma membrane. Essential for specification of embryonic polarity and mesoderm induction.
Product Categories/Family for anti-MESDC2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
26,077 Da
NCBI Official Full Name
MESDC2 protein
NCBI Official Synonym Full Names
mesoderm development candidate 2
NCBI Official Symbol
MESDC2
NCBI Official Synonym Symbols
BOCA; MESD
NCBI Protein Information
LDLR chaperone MESD; mesoderm development protein; renal carcinoma antigen NY-REN-61
UniProt Protein Name
LDLR chaperone MESD
Protein Family
UniProt Gene Name
MESDC2
UniProt Synonym Gene Names
KIAA0081; MESD
UniProt Entry Name
MESD_HUMAN

Uniprot Description

MESDC2: Chaperone specifically assisting the folding of beta- propeller/EGF modules within the family of low-density lipoprotein receptors (LDLRs). Acts as a modulator of the Wnt pathway through chaperoning the coreceptors of the canonical Wnt pathway, LRP5 and LRP6, to the plasma membrane. Essential for specification of embryonic polarity and mesoderm induction. Monomer. Interacts with LRP5; the interaction prevents LRP5 from forming aggregates and chaperones LRP6 to the plasma membrane. Interacts with LRP6; the interaction prevents LRP6 from forming aggregates and chaperones LRP6 to the plasma membrane. Belongs to the MESD family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 15q13

Cellular Component: endoplasmic reticulum; plasma membrane

Molecular Function: low-density lipoprotein receptor binding

Biological Process: Wnt receptor signaling pathway; protein folding; mesoderm development

Research Articles on MESDC2

Similar Products

Product Notes

The MESDC2 mesdc2 (Catalog #AAA6006336) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MESDC2 (KIAA0081, MESD, LDLR Chaperone MESD, Mesoderm Development Candidate 2, Mesoderm Development Protein, Renal Carcinoma Antigen NY-REN-61) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MESDC2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the MESDC2 mesdc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAASRWARKA VVLLCASDLL LLLLLLPPPG SCAAEGSPGT PDESTPPPRK KKKDIRDYND ADMARLLEQW EKDDDIEEGD LPEHKRPSAP VDFSKIDPSK PESILKMTKK GKTLMMFVTV SGSPTEKETE EITSLWQGSL FNANYDVQRF IVGSDRAIFM LRDGSYAWEI KDFLVGQDRC ADVTLEGQVY PGKGGGSKEK NKTKQDKGKK KKEGDLKSRS SKEENRAGNK REDL. It is sometimes possible for the material contained within the vial of "MESDC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.