Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: TCF7L2Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

Rabbit anti-Human TCF7L2 Polyclonal Antibody | anti-TCF7L2 antibody

TCF7L2 Antibody - N-terminal region

Gene Names
TCF7L2; TCF4; TCF-4
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TCF7L2; Polyclonal Antibody; TCF7L2 Antibody - N-terminal region; anti-TCF7L2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN
Sequence Length
619
Applicable Applications for anti-TCF7L2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 75%; Guinea Pig: 75%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TCF7L2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: TCF7L2Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: TCF7L2Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
Related Product Information for anti-TCF7L2 antibody
This is a rabbit polyclonal antibody against Tcf7l2. It was validated on Western Blot

Target Description: This gene encodes a high mobility group (HMG) box-containing transcription factor that plays a key role in the Wnt signaling pathway. The protein has been implicated in blood glucose homeostasis. Genetic variants of this gene are associated with increased risk of type 2 diabetes. Several transcript variants encoding multiple different isoforms have been found for this gene.
Product Categories/Family for anti-TCF7L2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68 kDa
NCBI Official Synonym Full Names
transcription factor 7 like 2
NCBI Official Symbol
TCF7L2
NCBI Official Synonym Symbols
TCF4; TCF-4
NCBI Protein Information
transcription factor 7-like 2
UniProt Protein Name
Transcription factor 7-like 2
Protein Family
UniProt Gene Name
TCF7L2
UniProt Synonym Gene Names
TCF4; T-cell factor 4; TCF-4; hTCF-4
UniProt Entry Name
TF7L2_HUMAN

NCBI Description

This gene encodes a high mobility group (HMG) box-containing transcription factor that plays a key role in the Wnt signaling pathway. The protein has been implicated in blood glucose homeostasis. Genetic variants of this gene are associated with increased risk of type 2 diabetes. Several transcript variants encoding multiple different isoforms have been found for this gene.[provided by RefSeq, Oct 2010]

Uniprot Description

TCF7L2: Participates in the Wnt signaling pathway and modulates MYC expression by binding to its promoter in a sequence-specific manner. Acts as repressor in the absence of CTNNB1, and as activator in its presence. Activates transcription from promoters with several copies of the Tcf motif 5'-CCTTTGATC-3' in the presence of CTNNB1. TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by TCF7L2/TCF4 and CTNNB1. Expression of dominant-negative mutants results in cell-cycle arrest in G1. Necessary for the maintenance of the epithelial stem-cell compartment of the small intestine. Interacts with TGFB1I1. Interacts with CTNNB1 (via the armadillo repeat); forms stable transcription complex. Interacts with EP300. Interacts with NLK. Interacts with CCDC85B (probably through the HMG box); prevents interaction with CTNNB1. Interacts with TNIK. Interacts with MAD2L2; prevents TCF7L2/TCF4 binding to promZIPK/DAPK3oters, negatively modulating its transcriptional activity. Interacts with ZIPK/DAPK3. Interacts with XIAP/BIRC4 and TLE3. Detected in epithelium from small intestine, with the highest expression at the top of the crypts and a gradient of expression from crypt to villus. Detected in colon epithelium and colon cancer, and in epithelium from mammary gland and carcinomas derived therefrom. Belongs to the TCF/LEF family. 10 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; Motility/polarity/chemotaxis; DNA-binding; Transcription factor; Cell development/differentiation; Cell cycle regulation

Chromosomal Location of Human Ortholog: 10q25.3

Cellular Component: nucleoplasm; transcription factor complex; PML body; cytoplasm; nuclear chromatin; nucleus

Molecular Function: protein binding; sequence-specific DNA binding; gamma-catenin binding; beta-catenin binding; chromatin binding; transcription factor binding; transcription factor activity; protein kinase binding; nuclear hormone receptor binding

Biological Process: neural tube development; skin development; glycogen metabolic process; fat cell differentiation; regulation of myelination; somatic stem cell maintenance; positive regulation of apoptosis; Wnt receptor signaling pathway through beta-catenin; glucose homeostasis; maintenance of DNA repeat elements; negative regulation of BMP signaling pathway; post-embryonic development; embryonic digestive tract morphogenesis; response to glucose stimulus; cell cycle arrest; oligodendrocyte development; embryonic hindgut morphogenesis; embryonic genitalia morphogenesis; regulation of hormone metabolic process; transcription, DNA-dependent; regulation of smooth muscle cell proliferation; negative regulation of transcription factor activity; glucose metabolic process; positive regulation of insulin secretion; cellular response to starvation; negative regulation of organ growth; negative regulation of fat cell differentiation; regulation of transcription from RNA polymerase II promoter; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; positive regulation of epithelial cell proliferation; secretory granule localization; myoblast cell fate commitment; positive regulation of protein binding; negative regulation of fibroblast growth factor receptor signaling pathway; regulation of oligodendrocyte differentiation; negative regulation of transcription from RNA polymerase II promoter; bone mineralization; positive regulation of protein export from nucleus; positive regulation of gluconeogenesis; pancreas development; blood vessel development; multicellular organism growth; odontogenesis of dentine-containing teeth; positive regulation of protein kinase B signaling cascade; cell proliferation; generation of neurons; pituitary gland development; regulation of skeletal muscle development; brain development

Disease: Diabetes Mellitus, Noninsulin-dependent

Research Articles on TCF7L2

Similar Products

Product Notes

The TCF7L2 tcf7l2 (Catalog #AAA3204761) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TCF7L2 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TCF7L2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TCF7L2 tcf7l2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MPQLNGGGGD DLGANDELIS FKDEGEQEEK SSENSSAERD LADVKSSLVN. It is sometimes possible for the material contained within the vial of "TCF7L2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.