Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: TCF7Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Rabbit TCF7 Polyclonal Antibody | anti-TCF7 antibody

TCF7 antibody - N-terminal region

Gene Names
TCF7; TCF-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TCF7; Polyclonal Antibody; TCF7 antibody - N-terminal region; anti-TCF7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQKQVHRPLQTP
Sequence Length
269
Applicable Applications for anti-TCF7 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TCF7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: TCF7Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: TCF7Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
Related Product Information for anti-TCF7 antibody
This is a rabbit polyclonal antibody against TCF7. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The T-cell-specific transcription factor TCF7 activates genes involved in immune regulation and is a candidate locus for genetic susceptibility to type 1 diabetes.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
transcription factor 7 isoform 3
NCBI Official Synonym Full Names
transcription factor 7
NCBI Official Symbol
TCF7
NCBI Official Synonym Symbols
TCF-1
NCBI Protein Information
transcription factor 7
UniProt Protein Name
Transcription factor 7
Protein Family
UniProt Gene Name
TCF7
UniProt Synonym Gene Names
TCF1; TCF-7; T-cell factor 1; TCF-1
UniProt Entry Name
TCF7_HUMAN

NCBI Description

This gene encodes a member of the T-cell factor/lymphoid enhancer-binding factor family of high mobility group (HMG) box transcriptional activators. This gene is expressed predominantly in T-cells and plays a critical role in natural killer cell and innate lymphoid cell development. The encoded protein forms a complex with beta-catenin and activates transcription through a Wnt/beta-catenin signaling pathway. Mice with a knockout of this gene are viable and fertile, but display a block in T-lymphocyte differentiation. Alternative splicing results in multiple transcript variants. Naturally-occurring isoforms lacking the N-terminal beta-catenin interaction domain may act as dominant negative regulators of Wnt signaling. [provided by RefSeq, Oct 2016]

Uniprot Description

TCF7: Transcriptional activator involved in T-cell lymphocyte differentiation. Necessary for the survival of CD4(+) CD8(+) immature thymocytes. Isoforms lacking the N-terminal CTNNB1 binding domain cannot fulfill this role. Binds to the T- lymphocyte-specific enhancer element (5'-WWCAAAG-3') found in the promoter of the CD3E gene. May also act as feedback transcriptional repressor of CTNNB1 and TCF7L2 target genes. TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by TCF7 and CTNNB1. Binds the armadillo repeat of CTNNB1 and forms a stable complex. Interacts with AES, TLE1, TLE2, TLE3 and TLE4. By TCF7L2 and CTNNB1. Predominantly expressed in T-cells. Also detected in proliferating intestinal epithelial cells and in the basal epithelial cells of mammary gland epithelium. Belongs to the TCF/LEF family. 16 isoforms of the human protein are produced by alternative promoter.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: nucleoplasm; transcription factor complex; nucleus

Molecular Function: protein binding; sequence-specific DNA binding; beta-catenin binding; chromatin binding; transcription factor activity

Biological Process: neural tube development; transcription, DNA-dependent; alpha-beta T cell differentiation; Wnt receptor signaling pathway through beta-catenin; regulation of cell proliferation; regulation of transcription from RNA polymerase II promoter; embryonic digestive tract morphogenesis; generation of neurons; T cell receptor V(D)J recombination; immune response; brain development; embryonic genitalia morphogenesis; embryonic hindgut morphogenesis

Research Articles on TCF7

Similar Products

Product Notes

The TCF7 tcf7 (Catalog #AAA3202289) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TCF7 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TCF7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TCF7 tcf7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PQPQPPLHKA NQPPHGVPQL SLYEHFNSPH PTPAPADISQ KQVHRPLQTP. It is sometimes possible for the material contained within the vial of "TCF7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.