Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of TCEAL1 expression in transfected 293T cell line by TCEAL1 polyclonal antibody. Lane 1: TCEAL1 transfected lysate (18.6kD). Lane 2: Non-transfected lysate. )

Rabbit anti-Human TCEAL1 Polyclonal Antibody | anti-TCEAL1 antibody

TCEAL1 (Transcription Elongation Factor A Protein-like 1, TCEA-like Protein 1, pp21, Nuclear Phosphoprotein p21/SIIR, SIIR, Transcription Elongation Factor S-II Protein-like 1) APC

Gene Names
TCEAL1; p21; SIIR; WEX9; pp21
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TCEAL1; Polyclonal Antibody; TCEAL1 (Transcription Elongation Factor A Protein-like 1; TCEA-like Protein 1; pp21; Nuclear Phosphoprotein p21/SIIR; SIIR; Transcription Elongation Factor S-II Protein-like 1) APC; anti-TCEAL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TCEAL1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1208
Applicable Applications for anti-TCEAL1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TCEAL1, aa1-159 (NP_001006640.1)
Immunogen Sequence
MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSEEEFFPEELLPELLPEMLLSEERPPQEGLSRKDLFEGRPPMEQPPCGVGKHKLEEGSFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRVRNKLMIMHWKAKRSRPYPI
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TCEAL1 expression in transfected 293T cell line by TCEAL1 polyclonal antibody. Lane 1: TCEAL1 transfected lysate (18.6kD). Lane 2: Non-transfected lysate. )

Western Blot (WB) (Western Blot analysis of TCEAL1 expression in transfected 293T cell line by TCEAL1 polyclonal antibody. Lane 1: TCEAL1 transfected lysate (18.6kD). Lane 2: Non-transfected lysate. )
Product Categories/Family for anti-TCEAL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Homo sapiens transcription elongation factor A like 1 (TCEAL1), transcript variant 2, mRNA
NCBI Official Synonym Full Names
transcription elongation factor A like 1
NCBI Official Symbol
TCEAL1
NCBI Official Synonym Symbols
p21; SIIR; WEX9; pp21
NCBI Protein Information
transcription elongation factor A protein-like 1

NCBI Description

This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. The encoded protein is similar to transcription elongation factor A/transcription factor SII and contains a zinc finger-like motif as well as a sequence related to the transcription factor SII Pol II-binding region. It may exert its effects via protein-protein interactions with other transcriptional regulators rather than via direct binding of DNA. Multiple family members are located on the X chromosome. Alternative splicing results in multiple transcript variants encoding a single isoform. [provided by RefSeq, Jul 2008]

Research Articles on TCEAL1

Similar Products

Product Notes

The TCEAL1 (Catalog #AAA6396171) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TCEAL1 (Transcription Elongation Factor A Protein-like 1, TCEA-like Protein 1, pp21, Nuclear Phosphoprotein p21/SIIR, SIIR, Transcription Elongation Factor S-II Protein-like 1) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TCEAL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TCEAL1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TCEAL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.