Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human, Mouse TBX22 Polyclonal Antibody | anti-TBX22 antibody

TBX22 (T-box Transcription Factor TBX22, T-box Protein 22, TBOX22) (MaxLight 405)

Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TBX22; Polyclonal Antibody; TBX22 (T-box Transcription Factor TBX22; T-box Protein 22; TBOX22) (MaxLight 405); anti-TBX22 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TBX22. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Sequence Length
520
Applicable Applications for anti-TBX22 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TBX22, aa1-520 (NP_058650.1).
Immunogen Sequence
MALSSRARAFSVEALVGRPSKRKLQDPIQAEQPELREKKGGEEEEERRSSAAGKSEPLEKQPKTEPSTSASSGCGSDSGYGNSSESLEEKDIQMELQGSELWKRFHDIGTEMIITKAGRRMFPSVRVKVKGLDPGKQYHVAIDVVPVDSKRYRYVYHSSQWMVAGNTDHLCIIPRFYVHPDSPCSGETWMRQIISFDRMKLTNNEMDDKGHIILQSMHKYKPRVHVIEQGSSVDLSQIQSLPTEGVKTFSFKETEFTTVTAYQNQQITKLKIERNPFAKGFRDTGRNRGVLDGLLETYPWRPSFTLDFKTFGADTQSGSSGSSPVTSSGGAPSPLNSLLSPLCFSPMFHLPTSSLGMPCPEAYLPNVNLPLCYKICPTNFWQQQPLVLPAPERLASSNSSQSLAPLMMEVPMLSSLGVTNSKSGSSEDSSDQYLQAPNSTNQMLYGLQSPGNIFLPNSITPEALSCSFHPSYDFYRYNFSMPSRLISGSNHLKVNDDSQVSFGEGKCNHVHWYPAINHYL
Conjugate
MaxLight405
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-TBX22 antibody
T-box transcription factors contain a novel type of DNA-binding domain, the T-box domain, which are encoded by an ancient gene family. Four T-box genes, omb, Trg, org-1, and H15, have been identified in Drosophila, whereas in mammals the T-box gene family has expanded, and 12 human T-box genes have been isolated. Most T-box genes have discrete spatial and temporal patterns of expression during embryogenesis. Mutations in T-box 22 (TBX22) have been associated with the inherited X-linked disorder cleft palate with ankyloglossia. There is evidence that TBX22 seems to play a major role in human palatogenesis. In mouse embryos, TBX22 is expressed in distinct areas of the head, namely the mesenchyme of the inferior nasal septum, the posterior palatal shelf before fusion, the attachment of the tongue, and mesenchymal cells surrounding the eye anlage.
Product Categories/Family for anti-TBX22 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
T-box transcription factor TBX22 isoform 1
UniProt Protein Name
T-box transcription factor TBX22
UniProt Gene Name
TBX22
UniProt Synonym Gene Names
TBOX22; T-box protein 22
UniProt Entry Name
TBX22_HUMAN

Uniprot Description

TBX22: Probable transcriptional regulator involved in developmental processes. This is major determinant crucial to palatogenesis. Defects in TBX22 are the cause of X-linked cleft palate with ankyloglossia (CPX). 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: Xq21.1

Cellular Component: nucleus

Molecular Function: DNA binding; transcription factor activity

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent; multicellular organismal development; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent

Disease: Cleft Palate With Or Without Ankyloglossia, X-linked; Abruzzo-erickson Syndrome

Similar Products

Product Notes

The TBX22 tbx22 (Catalog #AAA6396131) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TBX22 (T-box Transcription Factor TBX22, T-box Protein 22, TBOX22) (MaxLight 405) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TBX22 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TBX22 tbx22 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TBX22, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.