Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TBX22Sample Tissue: Human A549 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human TBX22 Polyclonal Antibody | anti-TBX22 antibody

TBX22 Antibody - middle region

Gene Names
TBX22; CPX; CLPA; TBXX; ABERS; dJ795G23.1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TBX22; Polyclonal Antibody; TBX22 Antibody - middle region; anti-TBX22 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: APLMMEVPMLSSLGVTNSKSGSSEDSSDQYLQAPNSTNQMLYGLQSPGNI
Sequence Length
520
Applicable Applications for anti-TBX22 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TBX22
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TBX22Sample Tissue: Human A549 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TBX22Sample Tissue: Human A549 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TBX22 antibody
This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Mutations in this gene have been associated with the inherited X-linked disorder, Cleft palate with ankyloglossia, and it is believed to play a major role in human palatogenesis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57 kDa
NCBI Official Full Name
T-box transcription factor TBX22 isoform 1
NCBI Official Synonym Full Names
T-box 22
NCBI Official Symbol
TBX22
NCBI Official Synonym Symbols
CPX; CLPA; TBXX; ABERS; dJ795G23.1
NCBI Protein Information
T-box transcription factor TBX22
UniProt Protein Name
T-box transcription factor TBX22
UniProt Gene Name
TBX22
UniProt Synonym Gene Names
TBOX22; T-box protein 22
UniProt Entry Name
TBX22_HUMAN

NCBI Description

This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Mutations in this gene have been associated with the inherited X-linked disorder, Cleft palate with ankyloglossia, and it is believed to play a major role in human palatogenesis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

TBX22: Probable transcriptional regulator involved in developmental processes. This is major determinant crucial to palatogenesis. Defects in TBX22 are the cause of X-linked cleft palate with ankyloglossia (CPX). 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: Xq21.1

Cellular Component: nucleus

Molecular Function: DNA binding; transcription factor activity

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent; multicellular organismal development; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent

Disease: Cleft Palate With Or Without Ankyloglossia, X-linked; Abruzzo-erickson Syndrome

Research Articles on TBX22

Similar Products

Product Notes

The TBX22 tbx22 (Catalog #AAA3223495) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TBX22 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TBX22 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TBX22 tbx22 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: APLMMEVPML SSLGVTNSKS GSSEDSSDQY LQAPNSTNQM LYGLQSPGNI. It is sometimes possible for the material contained within the vial of "TBX22, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.