Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TBP Antibody Titration: 2.5ug/mlPositive Control: Human Placenta)

Rabbit TBP Polyclonal Antibody | anti-TBP antibody

TBP antibody - middle region

Gene Names
TBP; HDL4; GTF2D; SCA17; TFIID; GTF2D1
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
TBP; Polyclonal Antibody; TBP antibody - middle region; anti-TBP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCD
Sequence Length
339
Applicable Applications for anti-TBP antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TBP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TBP Antibody Titration: 2.5ug/mlPositive Control: Human Placenta)

Western Blot (WB) (WB Suggested Anti-TBP Antibody Titration: 2.5ug/mlPositive Control: Human Placenta)
Related Product Information for anti-TBP antibody
This is a rabbit polyclonal antibody against TBP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes TBP, the TATA-binding protein. A distinctive feature of TBP is a long string of glutamines in the N-terminal. This region of the protein modulates the DNA binding activity of the C terminus, and modulation of DNA binding affects the rate of transcription complex formation and initiation of transcription. Mutations that expand the number of CAG repeats encoding this polyglutamine tract, and thus increase the length of the polyglutamine string, are associated with spinocerebellar ataxia 17, a neurodegenerative disorder classified as a polyglutamine disease.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
TATA-box-binding protein isoform 1
NCBI Official Synonym Full Names
TATA-box binding protein
NCBI Official Symbol
TBP
NCBI Official Synonym Symbols
HDL4; GTF2D; SCA17; TFIID; GTF2D1
NCBI Protein Information
TATA-box-binding protein
UniProt Protein Name
TATA-box-binding protein
Protein Family
UniProt Gene Name
TBP
UniProt Synonym Gene Names
GTF2D1; TF2D; TFIID
UniProt Entry Name
TBP_HUMAN

NCBI Description

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes TBP, the TATA-binding protein. A distinctive feature of TBP is a long string of glutamines in the N-terminus. This region of the protein modulates the DNA binding activity of the C terminus, and modulation of DNA binding affects the rate of transcription complex formation and initiation of transcription. The number of CAG repeats encoding the polyglutamine tract is usually 25-42, and expansion of the number of repeats to 45-66 increases the length of the polyglutamine string and is associated with spinocerebellar ataxia 17, a neurodegenerative disorder classified as a polyglutamine disease. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2016]

Uniprot Description

TBP: General transcription factor that functions at the core of the DNA-binding multiprotein factor TFIID. Binding of TFIID to the TATA box is the initial transcriptional step of the pre- initiation complex (PIC), playing a role in the activation of eukaryotic genes transcribed by RNA polymerase II. Component of the transcription factor SL1/TIF-IB complex, which is involved in the assembly of the PIC (preinitiation complex) during RNA polymerase I-dependent transcription. The rate of PIC formation probably is primarily dependent on the rate of association of SL1 with the rDNA promoter. SL1 is involved in stabilization of nucleolar transcription factor 1/UBTF on rDNA. Binds DNA as monomer. Belongs to the TFIID complex together with the TBP-associated factors (TAFs). Component of the transcription factor SL1/TIF-IB complex, composed of TBP and at least TAF1A, TAF1B TAF1C and TAF1D. Association of TBP to form either TFIID or SL1/TIF-IB appears to be mutually exclusive. Interacts with TAF1A, TAF1B and TAF1C. Interacts with TFIIB, NCOA6, DRAP1, DR1 and ELF3. Interacts with SPIB, SNAPC1, SNAPC2 and SNAPC4. Interacts with UTF1. Interacts with BRF2. Interacts with UBTF. Interacts with GPBP1. Interacts with CITED2. Interacts with ATF7IP. Interacts with HIV-1 Tat. Widely expressed, with levels highest in the testis and ovary. Belongs to the TBP family.

Protein type: Transcription initiation complex; DNA-binding; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 6q27

Cellular Component: nucleoplasm; transcription factor TFIID complex; male pronucleus; cytoplasm; female pronucleus; transcription factor TFIIA complex

Molecular Function: protein binding; transcription factor binding; transcription factor activity

Biological Process: chromatin silencing at rDNA; transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; viral reproduction; positive regulation of transcription, DNA-dependent; RNA elongation from RNA polymerase I promoter; transcription from RNA polymerase I promoter; termination of RNA polymerase I transcription; regulation of gene expression, epigenetic; transcription from RNA polymerase III promoter; negative regulation of gene expression, epigenetic; RNA elongation from RNA polymerase II promoter; gene expression; spermatogenesis; transcription initiation from RNA polymerase I promoter

Disease: Parkinson Disease, Late-onset; Spinocerebellar Ataxia 17

Research Articles on TBP

Similar Products

Product Notes

The TBP tbp (Catalog #AAA3224702) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TBP antibody - middle region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TBP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TBP tbp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FSSGKMVCTG AKSEEQSRLA ARKYARVVQK LGFPAKFLDF KIQNMVGSCD. It is sometimes possible for the material contained within the vial of "TBP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.