Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TBC1D20 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)

Rabbit TBC1D20 Polyclonal Antibody | anti-TBC1D20 antibody

TBC1D20 antibody - C-terminal region

Gene Names
TBC1D20; WARBM4; C20orf140
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TBC1D20; Polyclonal Antibody; TBC1D20 antibody - C-terminal region; anti-TBC1D20 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ERTAASTFKDFELASAQQRPDMVLRQRFRGLLRPEDRTKDVLTKPRTNRF
Sequence Length
403
Applicable Applications for anti-TBC1D20 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TBC1D20 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)

Western Blot (WB) (WB Suggested Anti-TBC1D20 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)
Related Product Information for anti-TBC1D20 antibody
This is a rabbit polyclonal antibody against TBC1D20. It was validated on Western Blot

Target Description: TBC1D20 may act as a GTPase-activating protein for Rab family protein(s).
Product Categories/Family for anti-TBC1D20 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
TBC1 domain family member 20
NCBI Official Synonym Full Names
TBC1 domain family member 20
NCBI Official Symbol
TBC1D20
NCBI Official Synonym Symbols
WARBM4; C20orf140
NCBI Protein Information
TBC1 domain family member 20
UniProt Protein Name
TBC1 domain family member 20
Protein Family
UniProt Gene Name
TBC1D20
UniProt Synonym Gene Names
C20orf140
UniProt Entry Name
TBC20_HUMAN

NCBI Description

This gene encodes a protein that belongs to a family of GTPase activator proteins of Rab-like small GTPases. The encoded protein and its cognate GTPase, Rab1, bind the nonstructural protein 5A (NS5A) of the hepatitis C virus (HCV) to mediate viral replication. Depletion of this protein inhibits replication of the virus and HCV infection. Mutations in this gene are associated with Warburg micro syndrome 4. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]

Uniprot Description

TBC1D20: May act as a GTPase-activating protein for Rab family protein(s). 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; GAPs, Rab; GAPs; Membrane protein, integral

Chromosomal Location of Human Ortholog: 20p13

Cellular Component: endoplasmic reticulum membrane; nuclear membrane; endoplasmic reticulum; integral to Golgi membrane

Molecular Function: protein binding; Rab GTPase binding

Biological Process: acrosome formation; ER to Golgi vesicle-mediated transport; positive regulation of viral protein levels in host cell; virus assembly; Golgi organization and biogenesis

Disease: Warburg Micro Syndrome 4

Research Articles on TBC1D20

Similar Products

Product Notes

The TBC1D20 tbc1d20 (Catalog #AAA3215718) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TBC1D20 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TBC1D20 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TBC1D20 tbc1d20 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ERTAASTFKD FELASAQQRP DMVLRQRFRG LLRPEDRTKD VLTKPRTNRF. It is sometimes possible for the material contained within the vial of "TBC1D20, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.