Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TAS2R45Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit TAS2R43 Polyclonal Antibody | anti-TAS2R43 antibody

TAS2R43 Antibody - C-terminal region

Gene Names
TAS2R43; T2R43; T2R52
Reactivity
Cow, Guinea Pig, Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TAS2R43; Polyclonal Antibody; TAS2R43 Antibody - C-terminal region; anti-TAS2R43 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MLANLVPFTVTLISFLLLVCSLCKHLKKMQLHGKGSQDPSTKVHIKVLQT
Sequence Length
299
Applicable Applications for anti-TAS2R43 antibody
Western Blot (WB)
Homology
Cow: 86%; Guinea Pig: 83%; Horse: 86%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human TAS2R43
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TAS2R45Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TAS2R45Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TAS2R43 antibody
This is a rabbit polyclonal antibody against TAS2R45. It was validated on Western Blot

Target Description: TAS2R43 belongs to the large TAS2R receptor family. TAS2Rs are expressed on the surface of taste receptor cells and mediate the perception of bitterness through a G protein-coupled second messenger pathway (Conte et al., 2002 [PubMed 12584440]). For further information on TAS2Rs, see MIM 604791.[supplied by OMIM, Mar 2009]
Product Categories/Family for anti-TAS2R43 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
taste receptor type 2 member 43
NCBI Official Synonym Full Names
taste 2 receptor member 43
NCBI Official Symbol
TAS2R43
NCBI Official Synonym Symbols
T2R43; T2R52
NCBI Protein Information
taste receptor type 2 member 43
UniProt Protein Name
Taste receptor type 2 member 43
Protein Family
UniProt Gene Name
TAS2R43
UniProt Synonym Gene Names
T2R43; T2R52
UniProt Entry Name
T2R43_HUMAN

NCBI Description

TAS2R43 belongs to the large TAS2R receptor family. TAS2Rs are expressed on the surface of taste receptor cells and mediate the perception of bitterness through a G protein-coupled second messenger pathway (Conte et al., 2002 [PubMed 12584440]). For further information on TAS2Rs, see MIM 604791.[supplied by OMIM, Mar 2009]

Uniprot Description

TAS2R43: Gustducin-coupled receptor immplicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5. Activated by the sulfonyl amide sweeteners saccharin and acesulfame K. In airway epithelial cells, binding of bitter compounds increases the intracellular calcium ion concentration and stimulates ciliary beat frequency. May act as chemosensory receptors in airway epithelial cells to detect and eliminate potential noxious agents from the airways. Belongs to the G-protein coupled receptor T2R family.

Protein type: GPCR, T2R family; Membrane protein, integral; Receptor, GPCR; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 12p13.2

Cellular Component: plasma membrane; integral to membrane

Molecular Function: bitter taste receptor activity; taste receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; detection of chemical stimulus involved in sensory perception of bitter taste

Research Articles on TAS2R43

Similar Products

Product Notes

The TAS2R43 tas2r43 (Catalog #AAA3218219) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAS2R43 Antibody - C-terminal region reacts with Cow, Guinea Pig, Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's TAS2R43 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TAS2R43 tas2r43 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MLANLVPFTV TLISFLLLVC SLCKHLKKMQ LHGKGSQDPS TKVHIKVLQT. It is sometimes possible for the material contained within the vial of "TAS2R43, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.