Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TAS2R3Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit TAS2R3 Polyclonal Antibody | anti-TAS2R3 antibody

TAS2R3 Antibody - C-terminal region

Gene Names
TAS2R3; T2R3
Reactivity
Dog, Human, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TAS2R3; Polyclonal Antibody; TAS2R3 Antibody - C-terminal region; anti-TAS2R3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RQMLQNGTSSRDPTTEAHKRAIRIILSFFFLFLLYFLAFLIASFGNFLPK
Sequence Length
316
Applicable Applications for anti-TAS2R3 antibody
Western Blot (WB)
Homology
Dog: 79%; Human: 100%; Sheep: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TAS2R3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TAS2R3Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TAS2R3Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TAS2R3 antibody
This is a rabbit polyclonal antibody against TAS2R3. It was validated on Western Blot

Target Description: This gene encodes a member of a family of candidate taste receptors that are members of the G protein-coupled receptor superfamily and that are specifically expressed by taste receptor cells of the tongue and palate epithelia. These apparently intronless taste receptor genes encode a 7-transmembrane receptor protein, functioning as a bitter taste receptor. This gene is clustered with another 3 candidate taste receptor genes in chromosome 7 and is genetically linked to loci that influence bitter perception.
Product Categories/Family for anti-TAS2R3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
taste receptor type 2 member 3
NCBI Official Synonym Full Names
taste 2 receptor member 3
NCBI Official Symbol
TAS2R3
NCBI Official Synonym Symbols
T2R3
NCBI Protein Information
taste receptor type 2 member 3
UniProt Protein Name
Taste receptor type 2 member 3
Protein Family
UniProt Gene Name
TAS2R3
UniProt Synonym Gene Names
T2R3
UniProt Entry Name
TA2R3_HUMAN

NCBI Description

This gene encodes a member of a family of candidate taste receptors that are members of the G protein-coupled receptor superfamily and that are specifically expressed by taste receptor cells of the tongue and palate epithelia. These apparently intronless taste receptor genes encode a 7-transmembrane receptor protein, functioning as a bitter taste receptor. This gene is clustered with another 3 candidate taste receptor genes in chromosome 7 and is genetically linked to loci that influence bitter perception. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Gustducin-coupled receptor implicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5. Ref.1 Ref.7

Subcellular location: Membrane; Multi-pass membrane protein.

Tissue specificity: Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells. Expressed in the antrum and fundus (part of the stomach), duodenum and in gastric endocrine cells. Ref.1

Miscellaneous: Several bitter taste receptors are expressed in a single taste receptor cell.

Sequence similarities: Belongs to the G-protein coupled receptor T2R family.

Sequence caution: The sequence AAU21157.1 differs from that shown. Reason: Erroneous initiation.

Research Articles on TAS2R3

Similar Products

Product Notes

The TAS2R3 tas2r3 (Catalog #AAA3217886) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAS2R3 Antibody - C-terminal region reacts with Dog, Human, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's TAS2R3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TAS2R3 tas2r3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RQMLQNGTSS RDPTTEAHKR AIRIILSFFF LFLLYFLAFL IASFGNFLPK. It is sometimes possible for the material contained within the vial of "TAS2R3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.