Rabbit TARDBP Polyclonal Antibody | anti-TARDBP antibody

TARDBP antibody - middle region

Cat. Num. AAA3202788

• Gene Names: TARDBP; ALS10; TDP-43
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
• Applications: Immunohistochemistry, Western Blot
• Purity: Affinity Purified
• Synonyms: TARDBP; Polyclonal Antibody; TARDBP antibody - middle region; anti-TARDBP antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: GISVHISNAEPKHNSNRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLGN
• Sequence Length: 414

• Applicable Applications for anti-TARDBP antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Homology: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TARDBP
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Immunohistochemistry with Thymus tissue at an antibody concentration of 5ug/ml using anti-TARDBP antibody )

Western Blot (WB)

(Host: RabbitTarget Name: TARDBPSample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-TARDBP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Muscle)

Related Product Information for anti-TARDBP antibody

This is a rabbit polyclonal antibody against TARDBP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. TARDBP is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription.HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Product Categories/Family for anti-TARDBP antibody

Polyclonal; Transcription Factor; RNA Binding Proteins; Transcription Regulation; Cell Cycle Proteins; Transcription Regulation; Immunohistochemistry; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 6678271
• NCBI GeneID: 23435
• NCBI Accession #: NP_031401
• NCBI GenBank Nucleotide #: NM_007375
• UniProt Accession #: Q13148
• Molecular Weight: 45kDa
• NCBI Official Full Name: TAR DNA-binding protein 43
• NCBI Official Synonym Full Names: TAR DNA binding protein
• NCBI Official Symbol: TARDBP
• NCBI Official Synonym Symbols: ALS10; TDP-43
• NCBI Protein Information: TAR DNA-binding protein 43
• UniProt Protein Name: TAR DNA-binding protein 43
• Protein Family: TAR DNA-binding protein
• UniProt Gene Name: TARDBP
• UniProt Synonym Gene Names: TDP43; TDP-43
• UniProt Entry Name: TADBP_HUMAN

NCBI Description

HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20. [provided by RefSeq, Jul 2008]