Rabbit TAPBP Polyclonal Antibody | anti-TAPBP antibody

TAPBP antibody - C-terminal region

Cat. Num. AAA3207757

• Gene Names: TAPBP; TPN; TAPA; TPSN; NGS17
• Reactivity: Cow, Human, Pig, Sheep
• Applications: Western Blot, Immunohistochemistry
• Purity: Affinity Purified
• Synonyms: TAPBP; Polyclonal Antibody; TAPBP antibody - C-terminal region; anti-TAPBP antibody

• Host: Rabbit
• Reactivity: Cow, Human, Pig, Sheep
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: GEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHS
• Sequence Length: 448

• Applicable Applications for anti-TAPBP antibody: Western Blot (WB), Immunohistochemistry (IHC)
• Homology: Cow: 86%; Human: 100%; Pig: 86%; Sheep: 86%
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TAPBP
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Skin )

Immunohistochemistry (IHC)

(Rabbit Anti-TAPBP AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult liverObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

Western Blot (WB)

(WB Suggested Anti-TAPBP Antibody Titration: 0.5ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB)

(WB Suggested Anti-TAPBP antibody Titration: 1 ug/mLSample Type: Human liver)

Related Product Information for anti-TAPBP antibody

This is a rabbit polyclonal antibody against TAPBP. It was validated on Western Blot and immunohistochemistry

Target Description: TAPBP is a transmembrane glycoprotein which mediates interaction between newly assembled major histocompatibility complex (MHC) class I molecules and the transporter associated with antigen processing (TAP), which is required for the transport of antigenic peptides across the endoplasmic reticulum membrane. This interaction is essential for optimal peptide loading on the MHC class I molecule. Up to four complexes of MHC class I and this protein may be bound to a single TAP molecule. This protein contains a C-terminal double-lysine motif (KKKAE) known to maintain membrane proteins in the endoplasmic reticulum.This gene encodes a transmembrane glycoprotein which mediates interaction between newly assembled major histocompatibility complex (MHC) class I molecules and the transporter associated with antigen processing (TAP), which is required for the transport of antigenic peptides across the endoplasmic reticulum membrane. This interaction is essential for optimal peptide loading on the MHC class I molecule. Up to four complexes of MHC class I and this protein may be bound to a single TAP molecule. This protein contains a C-terminal double-lysine motif (KKKAE) known to maintain membrane proteins in the endoplasmic reticulum. This gene lies within the major histocompatibility complex on chromosome 6. Alternative splicing results in three transcript variants encoding different isoforms.

Product Categories/Family for anti-TAPBP antibody

Polyclonal; Signal Proteins; Lymphocyte Signaling; Membrane Protein; Developmental Biology; Immunohistochemistry; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 27436893
• NCBI GeneID: 6892
• NCBI Accession #: NP_003181
• NCBI GenBank Nucleotide #: NM_003190
• UniProt Accession #: O15533
• Molecular Weight: 46kDa
• NCBI Official Full Name: tapasin isoform 1
• NCBI Official Synonym Full Names: TAP binding protein
• NCBI Official Symbol: TAPBP
• NCBI Official Synonym Symbols: TPN; TAPA; TPSN; NGS17
• NCBI Protein Information: tapasin
• UniProt Protein Name: Tapasin
• Protein Family: Tapasin
• UniProt Gene Name: TAPBP
• UniProt Synonym Gene Names: NGS17; TAPA; TPN; TPSN
• UniProt Entry Name: TPSN_HUMAN

NCBI Description

This gene encodes a transmembrane glycoprotein which mediates interaction between newly assembled major histocompatibility complex (MHC) class I molecules and the transporter associated with antigen processing (TAP), which is required for the transport of antigenic peptides across the endoplasmic reticulum membrane. This interaction is essential for optimal peptide loading on the MHC class I molecule. Up to four complexes of MHC class I and this protein may be bound to a single TAP molecule. This protein contains a C-terminal double-lysine motif (KKKAE) known to maintain membrane proteins in the endoplasmic reticulum. This gene lies within the major histocompatibility complex on chromosome 6. Alternative splicing results in three transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

TAPBP: Involved in the association of MHC class I with transporter associated with antigen processing (TAP) and in the assembly of MHC class I with peptide (peptide loading). 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: Golgi membrane; endoplasmic reticulum membrane; TAP complex; endoplasmic reticulum; integral to membrane

Molecular Function: protein binding; TAP1 binding; peptide antigen binding; MHC class I protein binding; unfolded protein binding; TAP2 binding; peptide antigen-transporting ATPase activity

Biological Process: peptide transport; antigen processing and presentation of peptide antigen via MHC class I; retrograde vesicle-mediated transport, Golgi to ER; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; peptide antigen stabilization; antigen processing and presentation of exogenous peptide antigen via MHC class I; immune response; protein complex assembly; amide transport; antigen processing and presentation of endogenous peptide antigen via MHC class I

Disease: Bare Lymphocyte Syndrome, Type I