anti-Human TAP2 Polyclonal Antibody | anti-TAP2 antibody

Anti-TAP2 Antibody

Cat. Num. AAA178054

• Gene Names: TAP2; APT2; PSF2; ABC18; ABCB3; PSF-2; RING11; D6S217E
• Reactivity: Human
• Applications: Western Blot
• Purity: Immunogen Affinity Purified
• Synonyms: TAP2; Polyclonal Antibody; Anti-TAP2 Antibody; Antigen peptide transporter 2; ABC transporter; MHC 2; ABC18; ABCB3; APT2; ATP binding cassette; sub family B (MDR/TAP); member 3; D6S217E; Peptide supply factor 2; Peptide transporter involved in antigen processing 2; Peptide transporter PSF2; Peptide transporter TAP2; PSF 2; PSF2; Really interesting new gene 11 protein; RING 11; RING11; TAP 2; Transporter 2 ATP binding cassette sub family B; Transporter 2; ABC (ATP binding cassette; sub family B (MDR/TAP) antibody; transporter 2; ATP-binding cassette; sub-family B (MDR/TAP); anti-TAP2 antibody

• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 703

• Applicable Applications for anti-TAP2 antibody: Western Blot (WB)
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TAP2 (611-651aa QKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSR), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti-TAP2 Picoband antibody, MBS178054, Western blottingAll lanes: Anti TAP2 (MBS178054) at 0.5ug/mlWB: HELA Whole Cell Lysate at 40ugPredicted bind size: 87KDObserved bind size: 87KD )

Related Product Information for anti-TAP2 antibody

Description: Rabbit IgG polyclonal antibody for Antigen peptide transporter 2(TAP2) detection. Tested with WB in Human.

Background: Transporter, ATP-binding cassette, major histocompatibility complex 2(TAP2) is a gene in humans that encodes the protein Antigen peptide transporter 2. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. The gene is assigned to human chromosome 6p21.3. It is located 7 kb telomeric to gene family member ABCB2. The protein encoded by this gene is involved in antigen presentation. And this protein forms a heterodimer with ABCB2 in order to transport peptides from the cytoplasm to the endoplasmic reticulum.

References

1. Bodmer JG, Marsh SG, Albert ED, Bodmer WF, Dupont B, Erlich HA, Mach B, Mayr WR, Parham P (Oct 1992). "Nomenclature for factors of the HLA system, 1991. WHO Nomenclature Committee for factors of the HLA system". Tissue Antigens 39 (4): 161-73. 2. Bahram S, Arnold D, Bresnahan M, Strominger JL, Spies T (Dec 1991). "Two putative subunits of a peptide pump encoded in the human major histocompatibility complex class II region". Proc Natl Acad Sci U S A 88 (22): 10094-8. 3. Hahn Y, Lee B (Feb 2006). "Human-specific nonsense mutations identified by genome sequence comparisons". Hum Genet 119 (1-2): 169-78.

NCBI and Uniprot Product Information

• NCBI GI #: 73747915
• NCBI GeneID: 6891
• NCBI Accession #: NP_000535.3
• NCBI GenBank Nucleotide #: NM_000544.3
• UniProt Accession #: Q03519; O95410; Q53FI6; Q5HY71; Q96PT8; Q9UQ83; B0V2J8
• Molecular Weight: 72,003 Da
• NCBI Official Full Name: antigen peptide transporter 2 isoform 1
• NCBI Official Synonym Full Names: transporter 2, ATP-binding cassette, sub-family B (MDR/TAP)
• NCBI Official Symbol: TAP2
• NCBI Official Synonym Symbols: APT2; PSF2; ABC18; ABCB3; PSF-2; RING11; D6S217E
• NCBI Protein Information: antigen peptide transporter 2
• UniProt Protein Name: Antigen peptide transporter 2
• Protein Family: Protein
• UniProt Gene Name: TAP2
• UniProt Synonym Gene Names: ABCB3; PSF2; RING11; Y1; APT2; PSF-2
• UniProt Entry Name: TAP2_HUMAN

NCBI Description

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. This gene is located 7 kb telomeric to gene family member ABCB2. The protein encoded by this gene is involved in antigen presentation. This protein forms a heterodimer with ABCB2 in order to transport peptides from the cytoplasm to the endoplasmic reticulum. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. Alternative splicing of this gene produces products which differ in peptide selectivity and level of restoration of surface expression of MHC class I molecules. [provided by RefSeq, Feb 2014]

Uniprot Description

TAP2: a 'transporter associated with antigen processing' (TAP) protein. Member of the ATP binding cassette (ABC) family of transmembrane transporters. Transports peptides across the endoplasmic reticulum membrane for assembly of major histocompatibility complex class I molecules. Two subunits, TAP1 and TAP2, are required for peptide transport. ATP hydrolysis is important for transport activity. Nascent MHC class I molecules associate with TAP via tapasin.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Transporter

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: endoplasmic reticulum membrane; integral to endoplasmic reticulum membrane; integral to membrane; membrane; TAP complex

Molecular Function: ATP binding; peptide antigen-transporting ATPase activity; peptide transporter activity; protein binding; TAP1 binding; tapasin binding; transporter activity

Biological Process: adaptive immune response; antigen processing and presentation of endogenous peptide antigen via MHC class I; antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-dependent; antigen processing and presentation of endogenous peptide antigen via MHC class Ib via ER pathway, TAP-dependent; antigen processing and presentation of exogenous protein antigen via MHC class Ib, TAP-dependent; antigen processing and presentation of peptide antigen via MHC class I; cytosol to ER transport; intracellular transport of viral proteins in host cell; metabolic process; peptide antigen transport; positive regulation of antigen processing and presentation of peptide antigen via MHC class I; transmembrane transport

Disease: Bare Lymphocyte Syndrome, Type I