Rabbit anti-Human TAF5L Polyclonal Antibody | anti-TAF5L antibody

TAF5L (TAF5-like RNA Polymerase II p300/CBP-associated Factor-associated Factor 65kD Subunit 5L, PCAF-associated Factor 65 beta, PAF65-beta, PAF65B) (FITC)

Cat. Num. AAA6395931

• Gene Names: TAF5L; PAF65B
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TAF5L; Polyclonal Antibody; TAF5L (TAF5-like RNA Polymerase II p300/CBP-associated Factor-associated Factor 65kD Subunit 5L; PCAF-associated Factor 65 beta; PAF65-beta; PAF65B) (FITC); anti-TAF5L antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human TAF5L.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
• Sequence Length: 4139

• Applicable Applications for anti-TAF5L antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human TAF5L, aa1-325 (NP_001020418.1).
• Immunogen Sequence: MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISPDSKLLAAGFDNSCIKLWSLRSKKLKSEPHQVDVSRIHLACDILEEEV
• Conjugate: FITC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TAF5L rabbit polyclonal antibody. Western Blot analysis of TAF5L expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of TAF5L expression in transfected 293T cell line by TAF5L polyclonal antibody. Lane 1: TAF5L transfected lysate (37kD). Lane 2: Non-transfected lysate)

Product Categories/Family for anti-TAF5L antibody

Antibodies; Enzymes; Polymerase

NCBI and Uniprot Product Information

• NCBI GI #: 69122930
• NCBI GeneID: 27097
• NCBI Accession #: NM_001025247.1
• NCBI GenBank Nucleotide #: NM_001025247.1
• UniProt Accession #: O75529
• NCBI Official Full Name: Homo sapiens TATA-box binding protein associated factor 5 like (TAF5L), transcript variant 2, mRNA
• NCBI Official Synonym Full Names: TATA-box binding protein associated factor 5 like
• NCBI Official Symbol: TAF5L
• NCBI Official Synonym Symbols: PAF65B
• NCBI Protein Information: TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L
• UniProt Protein Name: TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L
• Protein Family: TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor
• UniProt Gene Name: TAF5L
• UniProt Synonym Gene Names: PAF65B; PAF65-beta
• UniProt Entry Name: TAF5L_HUMAN

NCBI Description

The product of this gene belongs to the WD-repeat TAF5 family of proteins. This gene encodes a protein that is a component of the PCAF histone acetylase complex. The PCAF histone acetylase complex, which is composed of more than 20 polypeptides some of which are TAFs, is required for myogenic transcription and differentiation. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors to facilitate complex assembly and transcription initiation. The encoded protein is structurally similar to one of the histone-like TAFs, TAF5. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

TAF5L: Functions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex. Belongs to the WD repeat TAF5 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 1q42.13

Cellular Component: nucleoplasm; nucleus

Molecular Function: histone acetyltransferase activity; transcription coactivator activity; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; establishment and/or maintenance of chromatin architecture; regulation of transcription, DNA-dependent