Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TACC1Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human TACC1 Polyclonal Antibody | anti-TACC1 antibody

TACC1 Antibody - middle region

Gene Names
TACC1; Ga55
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TACC1; Polyclonal Antibody; TACC1 Antibody - middle region; anti-TACC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PKIQKDGISKSAGLEQPTDPVARDGPLSQTSSKPDPSQWESPSFNPFGSH
Sequence Length
731
Applicable Applications for anti-TACC1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TACC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TACC1Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TACC1Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TACC1 antibody
This locus may represent a breast cancer candidate gene. It is located close to FGFR1 on a region of chromosome 8 that is amplified in some breast cancers. Three transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-TACC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80 kDa
NCBI Official Full Name
transforming acidic coiled-coil-containing protein 1 isoform 2
NCBI Official Synonym Full Names
transforming acidic coiled-coil containing protein 1
NCBI Official Symbol
TACC1
NCBI Official Synonym Symbols
Ga55
NCBI Protein Information
transforming acidic coiled-coil-containing protein 1
UniProt Protein Name
Transforming acidic coiled-coil-containing protein 1
UniProt Gene Name
TACC1
UniProt Synonym Gene Names
KIAA1103
UniProt Entry Name
TACC1_HUMAN

NCBI Description

This locus may represent a breast cancer candidate gene. It is located close to FGFR1 on a region of chromosome 8 that is amplified in some breast cancers. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2017]

Uniprot Description

TACC1: Likely involved in the processes that promote cell division prior to the formation of differentiated tissues. Belongs to the TACC family. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytoskeletal; Cell development/differentiation

Chromosomal Location of Human Ortholog: 8p11.22

Cellular Component: microtubule cytoskeleton; intermediate filament cytoskeleton; cytoplasm; microtubule organizing center; nucleus

Molecular Function: protein domain specific binding; protein binding

Biological Process: cell proliferation; regulation of microtubule-based process; neurogenesis; cell division; cerebral cortex development; microtubule cytoskeleton organization and biogenesis; cell cycle; interkinetic nuclear migration

Research Articles on TACC1

Similar Products

Product Notes

The TACC1 tacc1 (Catalog #AAA3222574) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TACC1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TACC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TACC1 tacc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PKIQKDGISK SAGLEQPTDP VARDGPLSQT SSKPDPSQWE SPSFNPFGSH. It is sometimes possible for the material contained within the vial of "TACC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.