Rabbit TAC1 Polyclonal Antibody | anti-TAC1 antibody

TAC1 antibody - middle region

Cat. Num. AAA3214390

• Gene Names: TAC1; NK2; NPK; NKNA; TAC2; Hs.2563
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Sheep, Yeast
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: TAC1; Polyclonal Antibody; TAC1 antibody - middle region; anti-TAC1 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Sheep, Yeast
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEH
• Sequence Length: 114

• Applicable Applications for anti-TAC1 antibody: Western Blot (WB)
• Homology: Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Sheep: 92%; Yeast: 79%
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TAC1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TAC1 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)

Related Product Information for anti-TAC1 antibody

This is a rabbit polyclonal antibody against TAC1. It was validated on Western Blot

Target Description: This gene encodes four products of the tachykinin peptide hormone family, substance P and neurokinin A, as well as the related peptides, neuropeptide K and neuropeptide gamma. These hormones are thought to function as neurotransmitters which interact with nerve receptors and smooth muscle cells. They are known to induce behavioral responses and function as vasodilators and secretagogues. Multiple transcript variants encoding different isoforms have been found for this gene.

Product Categories/Family for anti-TAC1 antibody

Polyclonal; Cell Biology; Neuroscience; E3 & Ubiquitin

NCBI and Uniprot Product Information

• NCBI GI #: 7770077
• NCBI GeneID: 6863
• NCBI Accession #: NP_054703
• NCBI GenBank Nucleotide #: NM_013997
• UniProt Accession #: P20366
• Molecular Weight: 13kDa
• NCBI Official Full Name: protachykinin-1 isoform gamma
• NCBI Official Synonym Full Names: tachykinin precursor 1
• NCBI Official Symbol: TAC1
• NCBI Official Synonym Symbols: NK2; NPK; NKNA; TAC2; Hs.2563
• NCBI Protein Information: protachykinin-1
• UniProt Protein Name: Protachykinin-1
• Protein Family: Transcriptional regulator
• UniProt Gene Name: TAC1
• UniProt Synonym Gene Names: NKA; NKNA; TAC2; NKA; NPK
• UniProt Entry Name: TKN1_HUMAN

NCBI Description

This gene encodes four products of the tachykinin peptide hormone family, substance P and neurokinin A, as well as the related peptides, neuropeptide K and neuropeptide gamma. These hormones are thought to function as neurotransmitters which interact with nerve receptors and smooth muscle cells. They are known to induce behavioral responses and function as vasodilators and secretagogues. Substance P is an antimicrobial peptide with antibacterial and antifungal properties. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2014]

Uniprot Description

TAC1: Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles. Belongs to the tachykinin family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 7q21-q22

Cellular Component: extracellular space; cell soma; axon; extracellular region; plasma membrane

Molecular Function: protein binding; substance P receptor binding

Biological Process: tachykinin signaling pathway; negative regulation of heart rate; insemination; response to hormone stimulus; response to morphine; response to lipopolysaccharide; response to pain; sensory perception of pain; positive regulation of saliva secretion; synaptic transmission; elevation of cytosolic calcium ion concentration; cell-cell signaling; positive regulation of acute inflammatory response; positive regulation of lymphocyte proliferation; neuropeptide signaling pathway; regulation of blood pressure; positive regulation of stress fiber formation; positive regulation of action potential; inflammatory response; associative learning; detection of abiotic stimulus; positive regulation of synaptic transmission, cholinergic; positive regulation of synaptic transmission, GABAergic; positive regulation of ossification; long-term memory