Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SYPL1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Thymus)

Rabbit SYPL1 Polyclonal Antibody | anti-SYPL1 antibody

SYPL1 antibody - C-terminal region

Gene Names
SYPL1; SYPL; H-SP1
Reactivity
Dog, Horse, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SYPL1; Polyclonal Antibody; SYPL1 antibody - C-terminal region; anti-SYPL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MGSLNVSVIFGFLNMILWGGNAWFVYKETSLHSPSNTSAPHSQGGIPPPT
Sequence Length
259
Applicable Applications for anti-SYPL1 antibody
Western Blot (WB)
Homology
Dog: 85%; Horse: 77%; Human: 100%; Pig: 77%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SYPL1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Thymus)

Western Blot (WB) (WB Suggested Anti-SYPL1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Thymus)
Related Product Information for anti-SYPL1 antibody
This is a rabbit polyclonal antibody against SYPL1. It was validated on Western Blot

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-SYPL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
synaptophysin-like protein 1 isoform a
NCBI Official Synonym Full Names
synaptophysin like 1
NCBI Official Symbol
SYPL1
NCBI Official Synonym Symbols
SYPL; H-SP1
NCBI Protein Information
synaptophysin-like protein 1
UniProt Protein Name
Synaptophysin-like protein 1
UniProt Gene Name
SYPL1
UniProt Synonym Gene Names
SYPL
UniProt Entry Name
SYPL1_HUMAN

Uniprot Description

SYPL1: Belongs to the synaptophysin/synaptobrevin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 7q22.3

Cellular Component: synaptic vesicle; cytoplasmic vesicle membrane; integral to plasma membrane; integral to membrane; melanosome; secretory granule; integral to synaptic vesicle membrane

Molecular Function: transporter activity

Biological Process: synaptic transmission; transport

Research Articles on SYPL1

Similar Products

Product Notes

The SYPL1 sypl1 (Catalog #AAA3208324) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SYPL1 antibody - C-terminal region reacts with Dog, Horse, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's SYPL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SYPL1 sypl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MGSLNVSVIF GFLNMILWGG NAWFVYKETS LHSPSNTSAP HSQGGIPPPT. It is sometimes possible for the material contained within the vial of "SYPL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.