Rabbit anti-Human SYCP3 Polyclonal Antibody | anti-SYCP3 antibody

SYCP3 (Synaptonemal Complex Protein 3, SCP3, SCP-3, COR1, SPGF4) (FITC)

Cat. Num. AAA6395733

• Gene Names: SYCP3; COR1; SCP3; SPGF4; RPRGL4
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SYCP3; Polyclonal Antibody; SYCP3 (Synaptonemal Complex Protein 3; SCP3; SCP-3; COR1; SPGF4) (FITC); anti-SYCP3 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human SYCP3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).

• Applicable Applications for anti-SYCP3 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human SYCP3, aa1-236 (NP_710161.1).
• Immunogen Sequence: MVSSGKKYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEVQNMLEGVGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYSQQFLTLFQQWDLDMQKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLF
• Conjugate: FITC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SYCP3 expression in transfected 293T cell line by SYCP3 polyclonal antibody. Lane 1: SYCP3 transfected lysate (27.7kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-SYCP3 antibody

Antibodies; Cell Division Cycle (CDC)

NCBI and Uniprot Product Information

• NCBI GI #: 24233580
• NCBI GeneID: 50511
• NCBI Accession #: NP_710161.1
• NCBI GenBank Nucleotide #: NM_153694
• UniProt Accession #: Q8IZU3
• Molecular Weight: 27,729 Da
• NCBI Official Full Name: synaptonemal complex protein 3
• NCBI Official Synonym Full Names: synaptonemal complex protein 3
• NCBI Official Symbol: SYCP3
• NCBI Official Synonym Symbols: COR1; SCP3; SPGF4; RPRGL4
• NCBI Protein Information: synaptonemal complex protein 3
• UniProt Protein Name: Synaptonemal complex protein 3
• Protein Family: Synaptonemal complex protein
• UniProt Gene Name: SYCP3
• UniProt Synonym Gene Names: SCP3; SCP-3
• UniProt Entry Name: SYCP3_HUMAN

NCBI Description

This gene encodes an essential structural component of the synaptonemal complex. This complex is involved in synapsis, recombination and segregation of meiotic chromosomes. Mutations in this gene are associated with azoospermia in males and susceptibility to pregnancy loss in females. Alternate splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, May 2010]

Uniprot Description

SYCP3: Component of the transverse filaments of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Has an essential meiotic function in spermatogenesis. May be important for testis development. Defects in SYCP3 are the cause of spermatogenic failure type 4 (SPGF4). An infertility disorder characterized by azoospermia, a condition of having no sperm present in the ejaculate. Testicular histology shows arrest of spermatogenesis at the pachytene stage of primary spermatocytes. Belongs to the XLR/SYCP3 family.

Chromosomal Location of Human Ortholog: 12q

Cellular Component: chromosome; nucleus

Molecular Function: DNA binding

Biological Process: male meiosis I; cell division; spermatogenesis, exchange of chromosomal proteins

Disease: Spermatogenic Failure 4