Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SYCP3Sample Type: Esophagus Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit SYCP3 Polyclonal Antibody | anti-SYCP3 antibody

SYCP3 Antibody - N-terminal region

Gene Names
SYCP3; COR1; SCP3; SPGF4; RPRGL4
Reactivity
Cow, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SYCP3; Polyclonal Antibody; SYCP3 Antibody - N-terminal region; anti-SYCP3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKK
Sequence Length
236
Applicable Applications for anti-SYCP3 antibody
Western Blot (WB)
Homology
Cow: 86%; Horse: 79%; Human: 100%; Mouse: 79%; Pig: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SYCP3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SYCP3Sample Type: Esophagus Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SYCP3Sample Type: Esophagus Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SYCP3 antibody
This is a rabbit polyclonal antibody against SYCP3. It was validated on Western Blot

Target Description: This gene encodes an essential structural component of the synaptonemal complex. This complex is involved in synapsis, recombination and segregation of meiotic chromosomes. Mutations in this gene are associated with azoospermia in males and susceptibility to pregnancy loss in females. Alternate splicing results in multiple transcript variants that encode the same protein.
Product Categories/Family for anti-SYCP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
synaptonemal complex protein 3
NCBI Official Synonym Full Names
synaptonemal complex protein 3
NCBI Official Symbol
SYCP3
NCBI Official Synonym Symbols
COR1; SCP3; SPGF4; RPRGL4
NCBI Protein Information
synaptonemal complex protein 3
UniProt Protein Name
Synaptonemal complex protein 3
UniProt Gene Name
SYCP3
UniProt Synonym Gene Names
SCP3; SCP-3
UniProt Entry Name
SYCP3_HUMAN

NCBI Description

This gene encodes an essential structural component of the synaptonemal complex. This complex is involved in synapsis, recombination and segregation of meiotic chromosomes. Mutations in this gene are associated with azoospermia in males and susceptibility to pregnancy loss in females. Alternate splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, May 2010]

Uniprot Description

SYCP3: Component of the transverse filaments of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Has an essential meiotic function in spermatogenesis. May be important for testis development. Defects in SYCP3 are the cause of spermatogenic failure type 4 (SPGF4). An infertility disorder characterized by azoospermia, a condition of having no sperm present in the ejaculate. Testicular histology shows arrest of spermatogenesis at the pachytene stage of primary spermatocytes. Belongs to the XLR/SYCP3 family.

Chromosomal Location of Human Ortholog: 12q

Cellular Component: chromosome; nucleus

Molecular Function: DNA binding

Biological Process: male meiosis I; cell division; spermatogenesis, exchange of chromosomal proteins

Disease: Spermatogenic Failure 4

Research Articles on SYCP3

Similar Products

Product Notes

The SYCP3 sycp3 (Catalog #AAA3213844) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SYCP3 Antibody - N-terminal region reacts with Cow, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SYCP3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SYCP3 sycp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KYSRKSGKPS VEDQFTRAYD FETEDKKDLS GSEEDVIEGK TAVIEKRRKK. It is sometimes possible for the material contained within the vial of "SYCP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.