Immunohistochemistry (IHC)
(Human Intestine)
Rabbit SUV39H1 Polyclonal Antibody | anti-SUV39H1 antibody
SUV39H1 antibody - C-terminal region
Gene Names
SUV39H1; MG44; KMT1A; SUV39H; H3-K9-HMTase 1
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
SUV39H1; Polyclonal Antibody; SUV39H1 antibody - C-terminal region; anti-SUV39H1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
Sequence Length
412
Applicable Applications for anti-SUV39H1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SUV39H1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Human Intestine)
Immunohistochemistry (IHC)
(Human Intestine)
Immunohistochemistry (IHC)
(Rabbit Anti-SUV39H1 AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Immunohistochemistry (IHC)
(Rabbit Anti-SUV39H1 AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Western Blot (WB)
(WB Suggested Anti-SUV39H1 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysateSUV39H1 is supported by BioGPS gene expression data to be expressed in HepG2)
Western Blot (WB)
(WB Suggested Anti-SUV39H1 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysateSUV39H1 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-SUV39H1 antibody
This is a rabbit polyclonal antibody against SUV39H1. It was validated on Western Blot and immunohistochemistry
Target Description: SUV39H1, a human homolog of the Drosophila position effect variegation modifier Su(var)3-9 and of the S. pombe silencing factor clr4, encodes a heterochromatic protein that transiently accumulates at centromeric positions during mitosis.This gene is a member of the suppressor of variegation 3-9 homolog family and encodes a protein with a chromodomain and a C-terminal SET domain. This nuclear protein moves to the centromeres during mitosis and functions as a histone methyltransferase, methylating Lys-9 of histone H3. Overall, it plays a vital role in heterochromatin organization, chromosome segregation, and mitotic progression. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Target Description: SUV39H1, a human homolog of the Drosophila position effect variegation modifier Su(var)3-9 and of the S. pombe silencing factor clr4, encodes a heterochromatic protein that transiently accumulates at centromeric positions during mitosis.This gene is a member of the suppressor of variegation 3-9 homolog family and encodes a protein with a chromodomain and a C-terminal SET domain. This nuclear protein moves to the centromeres during mitosis and functions as a histone methyltransferase, methylating Lys-9 of histone H3. Overall, it plays a vital role in heterochromatin organization, chromosome segregation, and mitotic progression. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-SUV39H1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
histone-lysine N-methyltransferase SUV39H1 isoform 2
NCBI Official Synonym Full Names
suppressor of variegation 3-9 homolog 1
NCBI Official Symbol
SUV39H1
NCBI Official Synonym Symbols
MG44; KMT1A; SUV39H; H3-K9-HMTase 1
NCBI Protein Information
histone-lysine N-methyltransferase SUV39H1
UniProt Protein Name
Histone-lysine N-methyltransferase SUV39H1
Protein Family
UniProt Gene Name
SUV39H1
UniProt Synonym Gene Names
KMT1A; SUV39H; H3-K9-HMTase 1
UniProt Entry Name
SUV91_HUMAN
NCBI Description
This gene encodes an evolutionarily-conserved protein containing an N-terminal chromodomain and a C-terminal SET domain. The encoded protein is a histone methyltransferase that trimethylates lysine 9 of histone H3, which results in transcriptional gene silencing. Loss of function of this gene disrupts heterochromatin formation and may cause chromosome instability. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
Research Articles on SUV39H1
Similar Products
Product Notes
The SUV39H1 suv39h1 (Catalog #AAA3200961) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SUV39H1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SUV39H1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SUV39H1 suv39h1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FDYNMQVDPV DMESTRMDSN FGLAGLPGSP KKRVRIECKC GTESCRKYLF. It is sometimes possible for the material contained within the vial of "SUV39H1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
