Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SUN2Sample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human SUN2 Polyclonal Antibody | anti-SUN2 antibody

SUN2 Antibody - N-terminal region

Gene Names
SUN2; UNC84B
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SUN2; Polyclonal Antibody; SUN2 Antibody - N-terminal region; anti-SUN2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RSQRLTRYSQGDDDGSSSSGGSSVAGSQSTLFKDSPLRTLKRKSSNMKRL
Sequence Length
717
Applicable Applications for anti-SUN2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SUN2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SUN2Sample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SUN2Sample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SUN2 antibody
This is a rabbit polyclonal antibody against SUN2. It was validated on Western Blot

Target Description: SUN1 (MIM 607723) and SUN2 are inner nuclear membrane (INM) proteins that play a major role in nuclear-cytoplasmic connection by formation of a 'bridge' across the nuclear envelope, known as the LINC complex, via interaction with the conserved luminal KASH domain of nesprins (e.g., SYNE1; MIM 608441) located in the outer nuclear membrane (ONM). The LINC complex provides a direct connection between the nuclear lamina and the cytoskeleton, which contributes to nuclear positioning and cellular rigidity.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78kDa
NCBI Official Synonym Full Names
Sad1 and UNC84 domain containing 2
NCBI Official Symbol
SUN2
NCBI Official Synonym Symbols
UNC84B
NCBI Protein Information
SUN domain-containing protein 2
UniProt Protein Name
SUN domain-containing protein 2
UniProt Gene Name
SUN2
UniProt Synonym Gene Names
FRIGG; KIAA0668; RAB5IP; UNC84B; Rab5IP
UniProt Entry Name
SUN2_HUMAN

NCBI Description

SUN1 (MIM 607723) and SUN2 are inner nuclear membrane (INM) proteins that play a major role in nuclear-cytoplasmic connection by formation of a 'bridge' across the nuclear envelope, known as the LINC complex, via interaction with the conserved luminal KASH domain of nesprins (e.g., SYNE1; MIM 608441) located in the outer nuclear membrane (ONM). The LINC complex provides a direct connection between the nuclear lamina and the cytoskeleton, which contributes to nuclear positioning and cellular rigidity (summary by Haque et al., 2010 [PubMed 19933576]).[supplied by OMIM, Nov 2010]

Uniprot Description

SUN2: a nuclear transmembrane protein. Forms part of a membrane-spanning fibrillar complex that interconnects attached meiotic telomeres with cytoplasmic structures. Together with SUN1 connects the nuclear envelope with the centrosome. Interacts with RAB5A. Reportedly expressed in the endosome where it may play a role in endosome fusion and endocytosis.

Protein type: Membrane protein, integral; Nuclear envelope

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: nuclear membrane; condensed nuclear chromosome; nuclear chromosome, telomeric region; endosome membrane; integral to nuclear inner membrane; nuclear envelope

Molecular Function: identical protein binding; protein binding; microtubule binding; lamin binding

Biological Process: mitotic spindle organization and biogenesis; centrosome localization; nuclear migration along microfilament; nuclear migration; nuclear membrane organization and biogenesis; positive regulation of cell migration

Research Articles on SUN2

Similar Products

Product Notes

The SUN2 sun2 (Catalog #AAA3220033) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SUN2 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SUN2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SUN2 sun2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RSQRLTRYSQ GDDDGSSSSG GSSVAGSQST LFKDSPLRTL KRKSSNMKRL. It is sometimes possible for the material contained within the vial of "SUN2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.