Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SUMO2 expression in transfected 293T cell line by SUMO2 polyclonal antibody. Lane 1: SUMO2 transfected lysate (10.9kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human SUMO2 Polyclonal Antibody | anti-SUMO2 antibody

SUMO2 (Small Ubiquitin-related Modifier 2, SUMO-2, HSMT3, SMT3 Homolog 2, SUMO-3, Sentrin-2, Ubiquitin-like Protein SMT3A, Smt3A, SMT3A, SMT3H2) (Biotin)

Gene Names
SUMO2; HSMT3; SMT3B; SUMO3; Smt3A; SMT3H2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SUMO2; Polyclonal Antibody; SUMO2 (Small Ubiquitin-related Modifier 2; SUMO-2; HSMT3; SMT3 Homolog 2; SUMO-3; Sentrin-2; Ubiquitin-like Protein SMT3A; Smt3A; SMT3A; SMT3H2) (Biotin); anti-SUMO2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SUMO2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-SUMO2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SUMO2, aa1-95 (NP_008868.3).
Immunogen Sequence
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SUMO2 expression in transfected 293T cell line by SUMO2 polyclonal antibody. Lane 1: SUMO2 transfected lysate (10.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SUMO2 expression in transfected 293T cell line by SUMO2 polyclonal antibody. Lane 1: SUMO2 transfected lysate (10.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-SUMO2 antibody
Sentrin-2 also known as SUMO-3 is a novel ubiquitin-like protein that can be conjugated to other proteins in a manner analogous to ubiquitination. It is a 95aa peptide that is 46% identical and 66% homologous to sentrin-1. Sentrin interacts with the death domains of Fas, TNFR1 (tumor necrosis factor receptor 1), PML (a tumor suppressor), Rad51 and Rad 52, which are involved in repairing dsDNA breaks, and with GAP1.
Product Categories/Family for anti-SUMO2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10,871 Da
NCBI Official Full Name
small ubiquitin-related modifier 2 isoform a
NCBI Official Synonym Full Names
small ubiquitin-like modifier 2
NCBI Official Symbol
SUMO2
NCBI Official Synonym Symbols
HSMT3; SMT3B; SUMO3; Smt3A; SMT3H2
NCBI Protein Information
small ubiquitin-related modifier 2; sentrin 2; SMT3 homolog 2; ubiquitin-like protein SMT3A; ubiquitin-like protein SMT3B; SMT3 suppressor of mif two 3 homolog 2
UniProt Protein Name
Small ubiquitin-related modifier 2
UniProt Gene Name
SUMO2
UniProt Synonym Gene Names
SMT3A; SMT3H2; SUMO-2; Smt3A
UniProt Entry Name
SUMO2_HUMAN

NCBI Description

This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last two amino acids of the carboxy-terminus have been cleaved off. Numerous pseudogenes have been reported for this gene. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

SUMO2: Ubiquitin-like protein that can be covalently attached to proteins as a monomer or as a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Polymeric SUMO2 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. Homotrimer (Potential). Crystal packing analysis suggests a possible trimeric assembly, of which the biological significance remains to be determined. Interacts with SAE2 and UBE2I. Covalently attached to a number of proteins. Interacts with PELP1. Interacts with USP25; the interaction sumoylates USP25. Broadly expressed. Belongs to the ubiquitin family. SUMO subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin-like modifier

Chromosomal Location of Human Ortholog: 17q25.1

Cellular Component: nucleoplasm; PML body; nucleus

Molecular Function: protein binding; ubiquitin protein ligase binding

Biological Process: cellular protein metabolic process; protein sumoylation; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; post-translational protein modification

Research Articles on SUMO2

Similar Products

Product Notes

The SUMO2 sumo2 (Catalog #AAA6395666) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SUMO2 (Small Ubiquitin-related Modifier 2, SUMO-2, HSMT3, SMT3 Homolog 2, SUMO-3, Sentrin-2, Ubiquitin-like Protein SMT3A, Smt3A, SMT3A, SMT3H2) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SUMO2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SUMO2 sumo2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SUMO2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.