Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SULT1A3 polyclonal antibody. Western Blot analysis of SULT1A3 expression in human liver.)

Mouse anti-Human SULT1A3 Polyclonal Antibody | anti-SULT1A3 antibody

SULT1A3 (Sulfotransferase 1A3/1A4, ST1A3/ST1A4, Aryl Sulfotransferase 1A3/1A4, Catecholamine-sulfating Phenol Sulfotransferase, HAST3, M-PST, Monoamine-sulfating Phenol Sulfotransferase, Placental Estrogen Sulfotransferase, Sulfotransferase, Monoamine-pre

Gene Names
SULT1A3; STM; HAST; HAST3; M-PST; ST1A5; TL-PST; ST1A3/ST1A4
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SULT1A3; Polyclonal Antibody; SULT1A3 (Sulfotransferase 1A3/1A4; ST1A3/ST1A4; Aryl Sulfotransferase 1A3/1A4; Catecholamine-sulfating Phenol Sulfotransferase; HAST3; M-PST; Monoamine-sulfating Phenol Sulfotransferase; Placental Estrogen Sulfotransferase; Sulfotransferase; Monoamine-pre; Anti -SULT1A3 (Sulfotransferase 1A3/1A4; anti-SULT1A3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SULT1A3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Applicable Applications for anti-SULT1A3 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human SULT1A3, aa1-296 (AAH14471).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SULT1A3 polyclonal antibody. Western Blot analysis of SULT1A3 expression in human liver.)

Western Blot (WB) (SULT1A3 polyclonal antibody. Western Blot analysis of SULT1A3 expression in human liver.)

Western Blot (WB)

(SULT1A3 polyclonal antibody. Western Blot analysis of SULT1A3 expression in HepG2.)

Western Blot (WB) (SULT1A3 polyclonal antibody. Western Blot analysis of SULT1A3 expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of SULT1A3 expression in transfected 293T cell line by SULT1A3 polyclonal antibody. Lane 1: SULT1A3 transfected lysate (32.56kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SULT1A3 expression in transfected 293T cell line by SULT1A3 polyclonal antibody. Lane 1: SULT1A3 transfected lysate (32.56kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-SULT1A3 antibody
The human Catecholamine-Sulfating Phenol Sulfotransferase (CSPS) is the only sulfotransferase that catalyses the sulfation of catecholamins, in particular the neurotransmitter dopamine, with high activity. CSPS is required for stimulation by Mn2+ of the sulfating activity and expressed in the human intestine, brain, platelet and other tissues. In the brain it may play a role in regulating the levels of dopamine. It also serves as a detoxifying function in the intestine, where it may detoxify potentially lethal dietary monoamines.
Product Categories/Family for anti-SULT1A3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,196 Da
NCBI Official Full Name
sulfotransferase 1A3/1A4
NCBI Official Synonym Full Names
sulfotransferase family, cytosolic, 1A, phenol-preferring, member 3
NCBI Official Symbol
SULT1A3
NCBI Official Synonym Symbols
STM; HAST; HAST3; M-PST; ST1A5; TL-PST; ST1A3/ST1A4
NCBI Protein Information
sulfotransferase 1A3/1A4; sulfokinase; phenol sulfotransferase 1A5; aryl sulfotransferase 1A3/1A4; dopamine-specific sulfotransferase; placental estrogen sulfotransferase; monoamine-sulfating phenosulfotransferase; catecholamine-sulfating phenol sulfotransferase; thermolabile (monoamine, M form) phenol sulfotransferase
UniProt Protein Name
Sulfotransferase 1A3/1A4
Protein Family
UniProt Gene Name
SULT1A3
UniProt Synonym Gene Names
STM; ST1A3/ST1A4; TL-PST
UniProt Entry Name
ST1A3_HUMAN

NCBI Description

Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a phenol sulfotransferase with thermolabile enzyme activity. Four sulfotransferase genes are located on the p arm of chromosome 16; this gene and SULT1A4 arose from a segmental duplication. This gene is the most centromeric of the four sulfotransferase genes. Read-through transcription exists between this gene and the upstream SLX1A (SLX1 structure-specific endonuclease subunit homolog A) gene that encodes a protein containing GIY-YIG domains. [provided by RefSeq, Nov 2010]

Uniprot Description

SULT1A3: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of phenolic monoamines (neurotransmitters such as dopamine, norepinephrine and serotonin) and phenolic and catechol drugs. Belongs to the sulfotransferase 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Energy Metabolism - sulfur; EC 2.8.2.1; Transferase

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: cytosol

Molecular Function: sulfotransferase activity; aryl sulfotransferase activity

Biological Process: steroid metabolic process; cellular protein metabolic process; unfolded protein response, activation of signaling protein activity; flavonoid metabolic process; unfolded protein response; xenobiotic metabolic process; sulfation; catecholamine metabolic process; 3'-phosphoadenosine 5'-phosphosulfate metabolic process

Research Articles on SULT1A3

Similar Products

Product Notes

The SULT1A3 sult1a3 (Catalog #AAA6006564) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SULT1A3 (Sulfotransferase 1A3/1A4, ST1A3/ST1A4, Aryl Sulfotransferase 1A3/1A4, Catecholamine-sulfating Phenol Sulfotransferase, HAST3, M-PST, Monoamine-sulfating Phenol Sulfotransferase, Placental Estrogen Sulfotransferase, Sulfotransferase, Monoamine-pre reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SULT1A3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the SULT1A3 sult1a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MELIQDTSRP PLEYVKGVPL IKYFAEALGP LQSFQARPDD LLINTYPKSG TTWVSQILDM IYQGGDLEKC NRAPIYVRVP FLEVNDPGEP SGLETLKDTP PPRLIKSHLP LALLPQTLLD QKVKVVYVAR NPKDVAVSYY HFHRMEKAHP EPGTWDSFLE KFMAGEVSYG SWYQHVQEWW ELSRTHPVLY LFYEDMKENP KREIQKILEF VGRSLPEETM DFMVQHTSFK EMKKNPMTNY TTVPQELMDH SISPFMRKGM AGDWKTTFTV AQNERFDADY AEKMAGCSLS FRSEL. It is sometimes possible for the material contained within the vial of "SULT1A3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.