Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-STXBP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:100Positive Control: Human brain)

Rabbit STXBP1 Polyclonal Antibody | anti-STXBP1 antibody

STXBP1 antibody - middle region

Gene Names
STXBP1; P67; NSEC1; UNC18; RBSEC1; MUNC18-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
STXBP1; Polyclonal Antibody; STXBP1 antibody - middle region; anti-STXBP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TRSSASFSTTAVSARYGHWHKNKAPGEYRSGPRLIIFILGGVSLNEMRCA
Sequence Length
594
Applicable Applications for anti-STXBP1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human STXBP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-STXBP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:100Positive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-STXBP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:100Positive Control: Human brain)
Related Product Information for anti-STXBP1 antibody
This is a rabbit polyclonal antibody against STXBP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: STXBP1 belongs to the STXBP/unc-18/SEC1 family. It may participate in the regulation of synaptic vesicle docking and fusion, possibly through interaction with GTP-binding proteins. The protein is essential for neurotransmission and binds syntaxin, a component of the synaptic vesicle fusion machinery probably in a 1:1 ratio. It can interact with syntaxins 1, 2, and 3 but not syntaxin 4.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Full Name
syntaxin-binding protein 1 isoform b
NCBI Official Synonym Full Names
syntaxin binding protein 1
NCBI Official Symbol
STXBP1
NCBI Official Synonym Symbols
P67; NSEC1; UNC18; RBSEC1; MUNC18-1
NCBI Protein Information
syntaxin-binding protein 1
UniProt Protein Name
Syntaxin-binding protein 1
Protein Family
UniProt Gene Name
STXBP1
UniProt Synonym Gene Names
UNC18A; Unc18-1; Unc-18A
UniProt Entry Name
STXB1_HUMAN

NCBI Description

This gene encodes a syntaxin-binding protein. The encoded protein appears to play a role in release of neurotransmitters via regulation of syntaxin, a transmembrane attachment protein receptor. Mutations in this gene have been associated with infantile epileptic encephalopathy-4. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2010]

Uniprot Description

STXBP1: may participate in the regulation of synaptic vesicle docking and fusion, possibly through interaction with GTP-binding proteins. Essential for neurotransmission and binds syntaxin, a component of the synaptic vesicle fusion machinery probably in a 1:1 ratio. Can interact with syntaxins 1, 2, and 3 but not syntaxin 4. May play a role in determining the specificity of intracellular fusion reactions. Two splice-variant isoforms have been described.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 9q34.1

Cellular Component: nucleoplasm; protein complex; mitochondrion; cytoplasm; plasma membrane; cytosol

Molecular Function: identical protein binding; protein domain specific binding; SNARE binding; syntaxin binding; syntaxin-1 binding; protein N-terminus binding; protein kinase binding

Biological Process: protein stabilization; synaptic vesicle maturation; neurotransmitter secretion; regulation of synaptic vesicle fusion to presynaptic membrane; positive regulation of calcium ion-dependent exocytosis; synaptic transmission; protein transport; platelet degranulation; axon target recognition; glutamate secretion; energy reserve metabolic process; neuromuscular synaptic transmission; negative regulation of neuron apoptosis; negative regulation of synaptic transmission, GABAergic; regulation of insulin secretion; vesicle docking during exocytosis

Disease: Epileptic Encephalopathy, Early Infantile, 4

Research Articles on STXBP1

Similar Products

Product Notes

The STXBP1 stxbp1 (Catalog #AAA3224526) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STXBP1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's STXBP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STXBP1 stxbp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TRSSASFSTT AVSARYGHWH KNKAPGEYRS GPRLIIFILG GVSLNEMRCA. It is sometimes possible for the material contained within the vial of "STXBP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.