Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-STX1A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)

Rabbit STX1A Polyclonal Antibody | anti-STX1A antibody

STX1A antibody - N-terminal region

Gene Names
STX1A; STX1; HPC-1; P35-1; SYN1A
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
STX1A; Polyclonal Antibody; STX1A antibody - N-terminal region; anti-STX1A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENV
Sequence Length
288
Applicable Applications for anti-STX1A antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human STX1A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-STX1A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)

Western Blot (WB) (WB Suggested Anti-STX1A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)
Related Product Information for anti-STX1A antibody
This is a rabbit polyclonal antibody against STX1A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Synaptic vesicles store neurotransmitters that are released during calcium-regulated exocytosis. The specificity of neurotransmitter release requires the localization of both synaptic vesicles and calcium channels to the presynaptic active zone. Syntaxins function in this vesicle fusion process. Syntaxins also serve as a substrate for botulinum neurotoxin type C, a metalloprotease that blocks exocytosis and has high affinity for a molecular complex that includes the alpha-latrotoxin receptor which produces explosive exocytosis. Synaptic vesicles store neurotransmitters that are released during calcium-regulated exocytosis. The specificity of neurotransmitter release requires the localization of both synaptic vesicles and calcium channels to the presynaptic active zone. Syntaxins function in this vesicle fusion process. Syntaxins also serve as a substrate for botulinum neurotoxin type C, a metalloprotease that blocks exocytosis and has high affinity for a molecular complex that includes the alpha-latrotoxin receptor (MIM 600565) which produces explosive exocytosis (Zhang et al., 1995 [PubMed 7622072]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1253 BC064644.1 1-1253 1254-2117 BC000444.2 1209-2072

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
syntaxin-1A isoform 1
NCBI Official Synonym Full Names
syntaxin 1A
NCBI Official Symbol
STX1A
NCBI Official Synonym Symbols
STX1; HPC-1; P35-1; SYN1A
NCBI Protein Information
syntaxin-1A
UniProt Protein Name
Syntaxin-1A
Protein Family
UniProt Gene Name
STX1A
UniProt Synonym Gene Names
STX1
UniProt Entry Name
STX1A_HUMAN

NCBI Description

This gene encodes a member of the syntaxin superfamily. Syntaxins are nervous system-specific proteins implicated in the docking of synaptic vesicles with the presynaptic plasma membrane. Syntaxins possess a single C-terminal transmembrane domain, a SNARE [Soluble NSF (N-ethylmaleimide-sensitive fusion protein)-Attachment protein REceptor] domain (known as H3), and an N-terminal regulatory domain (Habc). Syntaxins bind synaptotagmin in a calcium-dependent fashion and interact with voltage dependent calcium and potassium channels via the C-terminal H3 domain. This gene product is a key molecule in ion channel regulation and synaptic exocytosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Sep 2009]

Uniprot Description

STX1A: a type IV membrane protein involved in docking of synaptic vesicles at presynaptic active zones. May play a critical role in neurotransmitter exocytosis. Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A. Three splice variant isoforms have been described.

Protein type: Vesicle; Membrane protein, integral

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: SNARE complex; synaptic vesicle; neuron projection; synaptic vesicle membrane; extracellular region; plasma membrane; integral to membrane; endomembrane system; actomyosin; cytosol; cell junction; secretory granule

Molecular Function: protein binding, bridging; SNAP receptor activity; protein domain specific binding; myosin binding; protein N-terminus binding; calcium-dependent protein binding; ATP-dependent protein binding; SNARE binding; protein binding; chloride channel inhibitor activity; protein heterodimerization activity; myosin head/neck binding; calcium channel inhibitor activity; glycoprotein binding; kinase binding

Biological Process: response to gravity; neurotransmitter secretion; pathogenesis; positive regulation of neurotransmitter secretion; calcium ion-dependent exocytosis; synaptic vesicle fusion to presynaptic membrane; intracellular protein transport; synaptic transmission; vesicle docking; cellular protein metabolic process; glutamate secretion; energy reserve metabolic process; regulation of insulin secretion; secretion by cell; synaptic vesicle docking during exocytosis; positive regulation of exocytosis

Research Articles on STX1A

Similar Products

Product Notes

The STX1A stx1a (Catalog #AAA3224521) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STX1A antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's STX1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STX1A stx1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KDRTQELRTA KDSDDDDDVA VTVDRDRFMD EFFEQVEEIR GFIDKIAENV. It is sometimes possible for the material contained within the vial of "STX1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.