Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-STS Antibody Titration: 5.0ug/mlPositive Control: Human Placenta)

Rabbit STS Polyclonal Antibody | anti-STS antibody

STS antibody - C-terminal region

Gene Names
STS; ES; ASC; XLI; ARSC; SSDD; ARSC1
Reactivity
Cow, Guinea Pig, Horse, Human, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
STS; Polyclonal Antibody; STS antibody - C-terminal region; anti-STS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLFDISKDPRERNPLTPASEPRFYEILKVMQEAADRHTQTLPEVPDQFSW
Sequence Length
583
Applicable Applications for anti-STS antibody
Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 77%; Horse: 100%; Human: 100%; Rat: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human STS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-STS Antibody Titration: 5.0ug/mlPositive Control: Human Placenta)

Western Blot (WB) (WB Suggested Anti-STS Antibody Titration: 5.0ug/mlPositive Control: Human Placenta)
Related Product Information for anti-STS antibody
This is a rabbit polyclonal antibody against STS. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: STS catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in its gene are known to cause X-linked ichthyosisThe protein encoded by this gene catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The encoded protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in this gene are known to cause X-linked ichthyosis (XLI).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
412
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
steryl-sulfatase isoform 1
NCBI Official Synonym Full Names
steroid sulfatase
NCBI Official Symbol
STS
NCBI Official Synonym Symbols
ES; ASC; XLI; ARSC; SSDD; ARSC1
NCBI Protein Information
steryl-sulfatase
UniProt Protein Name
Steryl-sulfatase
Protein Family
UniProt Gene Name
STS
UniProt Synonym Gene Names
ARSC1; ASC
UniProt Entry Name
STS_HUMAN

NCBI Description

This gene encodes a multi-pass membrane protein that is localized to the endoplasmic reticulum. It belongs to the sulfatase family and hydrolyzes several 3-beta-hydroxysteroid sulfates, which serve as metabolic precursors for estrogens, androgens, and cholesterol. Mutations in this gene are associated with X-linked ichthyosis (XLI). Alternatively spliced transcript variants resulting from the use of different promoters have been described for this gene (PMID:17601726). [provided by RefSeq, Mar 2016]

Uniprot Description

STS: Conversion of sulfated steroid precursors to estrogens during pregnancy. Defects in STS are the cause of ichthyosis X-linked (IXL). Ichthyosis X-linked is a keratinization disorder manifesting with mild erythroderma and generalized exfoliation of the skin within a few weeks after birth. Affected boys later develop large, polygonal, dark brown scales, especially on the neck, extremities, trunk, and buttocks. Belongs to the sulfatase family.

Protein type: Lipid Metabolism - androgen and estrogen; Hydrolase; Membrane protein, multi-pass; EC 3.1.6.2; Membrane protein, integral

Chromosomal Location of Human Ortholog: Xp22.32

Cellular Component: Golgi apparatus; endoplasmic reticulum membrane; membrane; intracellular membrane-bound organelle; lysosome; endoplasmic reticulum lumen; endoplasmic reticulum; plasma membrane; integral to membrane; endosome

Molecular Function: metal ion binding; sulfuric ester hydrolase activity; steryl-sulfatase activity

Biological Process: epidermis development; sphingolipid metabolic process; cellular protein metabolic process; glycosphingolipid metabolic process; female pregnancy; post-translational protein modification; steroid catabolic process

Disease: Ichthyosis, X-linked

Research Articles on STS

Similar Products

Product Notes

The STS sts (Catalog #AAA3205993) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STS antibody - C-terminal region reacts with Cow, Guinea Pig, Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's STS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STS sts for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLFDISKDPR ERNPLTPASE PRFYEILKVM QEAADRHTQT LPEVPDQFSW. It is sometimes possible for the material contained within the vial of "STS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.