Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: STMN3Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human STMN3 Polyclonal Antibody | anti-STMN3 antibody

STMN3 Antibody - middle region

Gene Names
STMN3; SCLIP
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
STMN3; Polyclonal Antibody; STMN3 Antibody - middle region; anti-STMN3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EERRKTQEAQVLKQLAERREHEREVLHKALEENNNFSRQAEEKLNYKMEL
Sequence Length
169
Applicable Applications for anti-STMN3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human STMN3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: STMN3Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: STMN3Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-STMN3 antibody
This gene encodes a protein which is a member of the stathmin protein family. Members of this protein family form a complex with tubulins at a ratio of 2 tubulins for each stathmin protein. Microtubules require the ordered assembly of alpha- and beta-tubulins, and formation of a complex with stathmin disrupts microtubule formation and function. A pseudogene of this gene is located on chromosome 22. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-STMN3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18 kDa
NCBI Official Full Name
stathmin-3 isoform 2
NCBI Official Synonym Full Names
stathmin 3
NCBI Official Symbol
STMN3
NCBI Official Synonym Symbols
SCLIP
NCBI Protein Information
stathmin-3
UniProt Protein Name
Stathmin-3
Protein Family
UniProt Gene Name
STMN3
UniProt Synonym Gene Names
SCLIP
UniProt Entry Name
STMN3_HUMAN

NCBI Description

This gene encodes a protein which is a member of the stathmin protein family. Members of this protein family form a complex with tubulins at a ratio of 2 tubulins for each stathmin protein. Microtubules require the ordered assembly of alpha- and beta-tubulins, and formation of a complex with stathmin disrupts microtubule formation and function. A pseudogene of this gene is located on chromosome 22. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2013]

Uniprot Description

STMN3: Exhibits microtubule-destabilizing activity, which is antagonized by STAT3. Belongs to the stathmin family.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 20q13.3

Cellular Component: Golgi apparatus; neuron projection; growth cone; axon; cytoplasm

Molecular Function: tubulin binding; protein domain specific binding

Biological Process: negative regulation of Rac protein signal transduction; nervous system development; microtubule depolymerization; regulation of microtubule polymerization or depolymerization; cytoplasmic microtubule organization and biogenesis; neurite development; regulation of cytoskeleton organization and biogenesis

Research Articles on STMN3

Similar Products

Product Notes

The STMN3 stmn3 (Catalog #AAA3222616) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STMN3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STMN3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STMN3 stmn3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EERRKTQEAQ VLKQLAERRE HEREVLHKAL EENNNFSRQA EEKLNYKMEL. It is sometimes possible for the material contained within the vial of "STMN3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.