Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human, Mouse STMN1 Polyclonal Antibody | anti-STMN1 antibody

STMN1 (Stathmin, Leukemia-associated Phosphoprotein p18, Metablastin, Oncoprotein 18, Op18, Phosphoprotein p19, pp19, Prosolin, Protein Pr22, pp17, C1orf215, LAP18, OP18) (MaxLight 405)

Gene Names
STMN1; Lag; SMN; OP18; PP17; PP19; PR22; LAP18; C1orf215
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
STMN1; Polyclonal Antibody; STMN1 (Stathmin; Leukemia-associated Phosphoprotein p18; Metablastin; Oncoprotein 18; Op18; Phosphoprotein p19; pp19; Prosolin; Protein Pr22; pp17; C1orf215; LAP18; OP18) (MaxLight 405); anti-STMN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human STMN1. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-STMN1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human STMN1, aa1-149 (NP_005554.1).
Immunogen Sequence
MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD
Conjugate
MaxLight405
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-STMN1 antibody
Stathmin 1, a neuron-enriched soluble phosphoprotein is a ubiquitous, phylogenetically conserved protein present in the cytoplasm of cells in a variety of unphosphorylated and phosphorylated forms. Stathmin 1 is widely expressed in organisms ranging from Drosophila to humans and is especially highly expressed in the developing nervous system. Its expression is also elevated in a number of leukemias and solid tumors, which has led to the suggestion that it may be involved in tumorigenesis. The protein destabilizes microtubules and increases the frequency by which microtubule plus ends switch from growth to rapid shortening and thus plays an important role in linking cell signaling to the regulation of microtubule dynamics. Human Stathmin 1 has been mapped to chromosomal region 1p36.1-p35.
Product Categories/Family for anti-STMN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,824 Da
NCBI Official Full Name
stathmin isoform a
NCBI Official Synonym Full Names
stathmin 1
NCBI Official Symbol
STMN1
NCBI Official Synonym Symbols
Lag; SMN; OP18; PP17; PP19; PR22; LAP18; C1orf215
NCBI Protein Information
stathmin; prosolin; metablastin; oncoprotein 18; phosphoprotein 19; phosphoprotein p19; stathmin 1/oncoprotein 18; transmembrane protein C1orf215; leukemia-associated phosphoprotein p18
UniProt Protein Name
Stathmin
Protein Family
UniProt Gene Name
STMN1
UniProt Synonym Gene Names
C1orf215; LAP18; OP18; Op18; pp19
UniProt Entry Name
STMN1_HUMAN

NCBI Description

This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2009]

Uniprot Description

STMN1: a microtubule-associated protein involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Phosphorylation reduces tubulin binding 10-fold and suppresses the MT polymerization inhibition activity. Present in much greater abundance in cells from patients with acute leukemia of different subtypes than in normal peripheral blood lymphocytes, nonleukemic proliferating lymphoid cells, bone marrow cells, or cells from patients with chronic lymphoid or myeloid leukemia.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 1p36.11

Cellular Component: microtubule; neuron projection; membrane; cytoplasm; intracellular; cytosol

Molecular Function: tubulin binding; signal transducer activity

Biological Process: mitotic spindle organization and biogenesis; axonogenesis; negative regulation of microtubule polymerization; response to virus; microtubule depolymerization; positive regulation of cell motility; brain development; signal transduction; neurite development; regulation of cytoskeleton organization and biogenesis

Research Articles on STMN1

Similar Products

Product Notes

The STMN1 stmn1 (Catalog #AAA6395438) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STMN1 (Stathmin, Leukemia-associated Phosphoprotein p18, Metablastin, Oncoprotein 18, Op18, Phosphoprotein p19, pp19, Prosolin, Protein Pr22, pp17, C1orf215, LAP18, OP18) (MaxLight 405) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's STMN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STMN1 stmn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STMN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.