Western Blot (WB)
(WB Suggested Anti-STK33 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)
Rabbit anti-Human STK33 Polyclonal Antibody | anti-STK33 antibody
STK33 Antibody - N-terminal region
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
STK33; Polyclonal Antibody; STK33 Antibody - N-terminal region; anti-STK33 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VPPVLVVEMSQTSSIGSAESLISLERKKEKNINRDITSRKDLPSRTSNVE
Sequence Length
514
Applicable Applications for anti-STK33 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human STK33
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-STK33 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)
Western Blot (WB)
(WB Suggested Anti-STK33 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)
Related Product Information for anti-STK33 antibody
This is a rabbit polyclonal antibody against STK33. It was validated on Western Blot
Target Description: STK33 is a serine/threonine protein kinase which phosphorylates VIME. STK33 may play a specific role in the dynamic behavior of the intermediate filament cytoskeleton by phosphorylation of VIME By similarity. STK33 is not essential for the survival of KRAS-dependent AML cell lines.
Target Description: STK33 is a serine/threonine protein kinase which phosphorylates VIME. STK33 may play a specific role in the dynamic behavior of the intermediate filament cytoskeleton by phosphorylation of VIME By similarity. STK33 is not essential for the survival of KRAS-dependent AML cell lines.
Product Categories/Family for anti-STK33 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
serine/threonine-protein kinase 33 isoform a
NCBI Official Synonym Full Names
serine/threonine kinase 33
NCBI Official Symbol
STK33
NCBI Protein Information
serine/threonine-protein kinase 33
UniProt Protein Name
Serine/threonine-protein kinase 33
Protein Family
UniProt Gene Name
STK33
UniProt Entry Name
STK33_HUMAN
Uniprot Description
STK33: Serine/threonine protein kinase which phosphorylates VIME. May play a specific role in the dynamic behavior of the intermediate filament cytoskeleton by phosphorylation of VIME. Not essential for the survival of KRAS-dependent AML cell lines. Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: EC 2.7.11.1; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; Protein kinase, CAMK; CAMK group; CAMK-Unique family
Chromosomal Location of Human Ortholog: 11p15.3
Cellular Component: perinuclear region of cytoplasm
Molecular Function: protein serine/threonine kinase activity; ATP binding
Biological Process: protein amino acid autophosphorylation
Research Articles on STK33
Similar Products
Product Notes
The STK33 stk33 (Catalog #AAA3217052) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STK33 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STK33 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STK33 stk33 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VPPVLVVEMS QTSSIGSAES LISLERKKEK NINRDITSRK DLPSRTSNVE. It is sometimes possible for the material contained within the vial of "STK33, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
