Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Cdk5 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Heart)

Rabbit Cdk5 Polyclonal Antibody | anti-CDK5 antibody

Cdk5 Antibody - middle region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Cdk5; Polyclonal Antibody; Cdk5 Antibody - middle region; anti-CDK5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EIVKSLLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARA
Sequence Length
292
Applicable Applications for anti-CDK5 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Rat Cdk5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Cdk5 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Heart)

Western Blot (WB) (WB Suggested Anti-Cdk5 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Heart)
Related Product Information for anti-CDK5 antibody
This is a rabbit polyclonal antibody against Cdk5. It was validated on Western Blot

Target Description: Serine/threonine kinase is involved in synaptic regulation and neuronal development, phosphorylates synaptic protein Pctaire1 and regulates acetylcholine receptor expression.
Product Categories/Family for anti-CDK5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
cyclin-dependent-like kinase 5
NCBI Official Synonym Full Names
cyclin-dependent kinase 5
NCBI Official Symbol
Cdk5
NCBI Protein Information
cyclin-dependent-like kinase 5
UniProt Protein Name
Cyclin-dependent-like kinase 5
Protein Family
UniProt Gene Name
Cdk5
UniProt Synonym Gene Names
Cdkn5; TPKII catalytic subunit
UniProt Entry Name
CDK5_RAT

NCBI Description

serine/threonine kinase involved in synaptic regulation and neuronal development; phosphorylates synaptic protein Pctaire1; regulates acetylcholine receptor expression [RGD, Feb 2006]

Uniprot Description

CDK5: a protein kinase of the CDK family. Unlike other members of this family, it is not activated by cyclins but by p35 (CDK5R1) and p39. An important regulator of neuronal positioning during brain development. May also play a role in synaptogenesis and neurotransmission. Substrates include TAU, MAP2, NF-H and -M, Nudel, PDE6, beta-catenin, amphyphysin, dynamin I, synapsin 1, Munc-18, and NMDA receptor 2A. Plays a role in myogenesis, haematopoietic cell differentiation, spermatogenesis, insulin secretion, and lens differentiation. Implicated in the pathology of neurofibrillary tangles and formation of senile plaques, hallmarks of Alzheimer?s disease. Induces tau phosphorylation and aggregation and neurofibrillary tangle deposition and neurodegeneration in in vitro and in vivo animal models. Brain samples from Alzeimer?s pateints show elevated CDK5 activity.

Protein type: Kinase, protein; Protein kinase, CMGC; Cell cycle regulation; Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.1; CMGC group; CDK family; CDK5 subfamily; CDK/CDK5 subfamily

Cellular Component: axon; cell junction; cell soma; cyclin-dependent protein kinase 5 activator complex; cytoplasm; cytoskeleton; cytosol; dendrite; filopodium; growth cone; lamellipodium; membrane; neuromuscular junction; nucleolus; nucleus; perikaryon; plasma membrane; postsynaptic density; postsynaptic membrane

Molecular Function: acetylcholine receptor activator activity; ATP binding; cyclin-dependent protein kinase activity; cytoskeletal protein binding; ephrin receptor binding; ErbB-2 class receptor binding; ErbB-3 class receptor binding; kinase activity; p53 binding; protein binding; protein kinase activity; protein kinase binding; protein serine/threonine kinase activity; tau-protein kinase activity

Biological Process: apoptosis; associative learning; axon extension; axonogenesis; behavioral response to cocaine; cell division; cell migration; cell-matrix adhesion; central nervous system development; central nervous system neuron development; cerebellar cortex development; cerebellar cortex formation; cerebellum development; cerebral cortex development; corpus callosum development; cortical actin cytoskeleton organization and biogenesis; dendrite morphogenesis; exocytosis; forebrain development; hippocampus development; intracellular protein transport; layer formation in the cerebral cortex; motor axon guidance; negative regulation of axon extension; negative regulation of cell cycle; negative regulation of protein export from nucleus; negative regulation of protein ubiquitination; negative regulation of proteolysis; negative regulation of synaptic plasticity; negative regulation of transcription, DNA-dependent; neurite development; neurite morphogenesis; neuron apoptosis; neuron differentiation; neuron migration; nucleocytoplasmic transport; oligodendrocyte differentiation; peptidyl-serine phosphorylation; peptidyl-threonine phosphorylation; phosphorylation; positive regulation of calcium ion-dependent exocytosis; positive regulation of neuron apoptosis; positive regulation of protein binding; positive regulation of protein kinase activity; protein amino acid autophosphorylation; protein amino acid phosphorylation; receptor catabolic process; receptor clustering; regulated secretory pathway; regulation of cell migration; regulation of excitatory postsynaptic membrane potential; regulation of postsynaptic membrane potential; regulation of synaptic plasticity; response to cocaine; response to wounding; rhythmic process; Schwann cell development; sensory perception of pain; serine phosphorylation of STAT3 protein; skeletal muscle development; synaptic transmission, dopaminergic; synaptic transmission, glutamatergic; synaptic vesicle endocytosis; synaptogenesis; telencephalon development; visual learning

Research Articles on CDK5

Similar Products

Product Notes

The CDK5 cdk5 (Catalog #AAA3211558) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Cdk5 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Cdk5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CDK5 cdk5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EIVKSLLFQL LKGLGFCHSR NVLHRDLKPQ NLLINRNGEL KLADFGLARA. It is sometimes possible for the material contained within the vial of "Cdk5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.